JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152927

Recombinant Human Apelin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human Apelin protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 77 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

APEL, APLN, Apelin, APJ endogenous ligand

1 Images
SDS-PAGE - Recombinant Human Apelin protein (GST tag N-Terminus) (AB152927)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Apelin protein (GST tag N-Terminus) (AB152927)

ab152927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9ULZ1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":77,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9ULZ1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Apelin also known as APLN is a peptide ligand with a mass of approximately 77 amino acids. It has gained attention in scientific research due to its interaction with the G-protein coupled receptor named APJ (Apelin receptor). Apelin expresses widely in various tissues including heart lung kidney and gastrointestinal tract. This widespread expression suggests it plays roles in multiple physiological processes.
Biological function summary

Apelin acts as an important regulator of cardiovascular functions and fluid homeostasis. It modulates blood pressure and cardiac contractility indicating its role in maintaining cardiovascular health. Apelin operates independently but interacts closely with its receptor APJ forming a functional complex that initiates various intracellular signaling mechanisms. Researchers have noted its significant effects on the vascular system and potential involvement in angiogenesis.

Pathways

Apelin participates in the renin-angiotensin system and influences the nitric oxide signaling pathway. These pathways are important for maintaining vascular tone and pressure as well as for ensuring proper fluid balance in the body. Apelin's actions appear related to the angiotensin II type 1 receptor and endothelial nitric oxide synthase affecting their activity to achieve desired physiological outcomes. This involvement illustrates how apelin bridges different signaling networks to regulate homeostasis.

Apelin has connections to cardiovascular disorders and metabolic syndrome. High apelin levels have been observed in heart failure indicating its compensatory role in maintaining cardiovascular function. Additionally disruptions in apelin signaling may link to obesity-related diabetes given its effects on insulin sensitivity and energy metabolism. The interplay between apelin APJ and angiotensin II type 1 receptor highlights its potential as a therapeutic target for managing these conditions.

Specifications

Form

Liquid

General info

Function

Peptide hormone that functions as endogenous ligand for the G-protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed : 10525157, PubMed : 22810587, PubMed : 35817871, PubMed : 38428423). Functions as a balanced agonist activating both G(i) protein pathway and beta-arrestin pathway of APLNR (PubMed : 22810587, PubMed : 38428423). Downstream G proteins activation, apelin can inhibit cAMP production and activate key intracellular effectors such as ERKs (PubMed : 22810587, PubMed : 35817871, PubMed : 38428423). On the other hand, APLNR activation induces beta-arrestin recruitment to the membrane leading to desensitization and internalization of the receptor (PubMed : 22810587, PubMed : 38428423). Apelin blunts cardiac hypertrophic induction from APLNR on response to pathological stimuli, but also induces myocardial hypertrophy under normal conditions (PubMed : 22810587, PubMed : 38428423). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Involved in the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis (By similarity). Has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking; the oral intake of apelin in the colostrum and the milk might therefore modulate immune responses in neonates (By similarity). Plays a role in early coronary blood vessels formation (By similarity). Mediates myocardial contractility in an ERK1/2-dependent manner (By similarity). May also have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior (By similarity).. (Microbial infection) Endogenous ligand for the apelin receptor (APLNR), an alternative coreceptor with CD4 for HIV-1 infection (PubMed : 11090199). Inhibits HIV-1 entry in cells coexpressing CD4 and APLNR (PubMed : 11090199). Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives (PubMed : 11090199).

Sequence similarities

Belongs to the apelin family.

Post-translational modifications

Several active peptides may be produced by proteolytic processing of the peptide precursor.

Product protocols

Target data

Peptide hormone that functions as endogenous ligand for the G-protein-coupled apelin receptor (APLNR/APJ), that plays a role in cadiovascular homeostasis (PubMed : 10525157, PubMed : 22810587, PubMed : 35817871, PubMed : 38428423). Functions as a balanced agonist activating both G(i) protein pathway and beta-arrestin pathway of APLNR (PubMed : 22810587, PubMed : 38428423). Downstream G proteins activation, apelin can inhibit cAMP production and activate key intracellular effectors such as ERKs (PubMed : 22810587, PubMed : 35817871, PubMed : 38428423). On the other hand, APLNR activation induces beta-arrestin recruitment to the membrane leading to desensitization and internalization of the receptor (PubMed : 22810587, PubMed : 38428423). Apelin blunts cardiac hypertrophic induction from APLNR on response to pathological stimuli, but also induces myocardial hypertrophy under normal conditions (PubMed : 22810587, PubMed : 38428423). Apelin-36 dissociates more hardly than (pyroglu)apelin-13 from APLNR (By similarity). Involved in the regulation of cardiac precursor cell movements during gastrulation and heart morphogenesis (By similarity). Has an inhibitory effect on cytokine production in response to T-cell receptor/CD3 cross-linking; the oral intake of apelin in the colostrum and the milk might therefore modulate immune responses in neonates (By similarity). Plays a role in early coronary blood vessels formation (By similarity). Mediates myocardial contractility in an ERK1/2-dependent manner (By similarity). May also have a role in the central control of body fluid homeostasis by influencing vasopressin release and drinking behavior (By similarity).. (Microbial infection) Endogenous ligand for the apelin receptor (APLNR), an alternative coreceptor with CD4 for HIV-1 infection (PubMed : 11090199). Inhibits HIV-1 entry in cells coexpressing CD4 and APLNR (PubMed : 11090199). Apelin-36 has a greater inhibitory activity on HIV infection than other synthetic apelin derivatives (PubMed : 11090199).
See full target information APLN

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Oxidative medicine and cellular longevity 2023:5012474 PubMed36785790

2023

The Interaction of Apelin and FGFR1 Ameliorated the Kidney Fibrosis through Suppression of TGF-Induced Endothelial-to-Mesenchymal Transition.

Applications

Unspecified application

Species

Unspecified reactive species

Rongfen Gao,Yumin Wu,Qian Yang,Liangdong Chen,Jiwei Chen,Boyong Wang,Zeming Liu,Juan Jin,Jinpeng Li,Gaosong Wu

Frontiers in cardiovascular medicine 9:956041 PubMed36017090

2022

Empagliflozin prevents neointima formation by impairing smooth muscle cell proliferation and accelerating endothelial regeneration.

Applications

Unspecified application

Species

Unspecified reactive species

Jochen Dutzmann,Lena Marie Bode,Katrin Kalies,Laura Korte,Kai Knöpp,Frederik Julius Kloss,Mirja Sirisko,Claudia Pilowski,Susanne Koch,Heiko Schenk,Jan-Marcus Daniel,Johann Bauersachs,Daniel G Sedding
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com