JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB165460

Recombinant Human APOBEC3D protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human APOBEC3D protein is a Human Full Length protein, in the 1 to 386 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

APOBEC3DE, APOBEC3D, DNA dC->dU-editing enzyme APOBEC-3D, A3D, A3DE

1 Images
SDS-PAGE - Recombinant Human APOBEC3D protein (AB165460)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human APOBEC3D protein (AB165460)

ab165460 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q96AK3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":386,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q96AK3","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

APOBEC3D also known as APOBEC-related cytidine deaminase plays a role in the editing of nucleic acids by deaminating cytosine to uracil in single-stranded DNA. This protein possesses a mass of approximately 46 kDa. APOBEC3D is expressed primarily in lymphoid tissues including the spleen and lymph nodes. It belongs to a larger group of APOBEC family proteins that extend their functions to various aspects of nucleic acid metabolism.
Biological function summary

The protein modifies DNA sequences and contributes to the innate immune response which acts as a defense against viral infections. APOBEC3D participates as a component of the host's antiviral machinery generating mutations in viral genomes that can inhibit virus replication. While it does not form a stable complex akin to some of its family members such as APOBEC3G its activity associates with the presence of the APOBEC3 protein family acting coordinately in host cellular processes.

Pathways

APOBEC3D integrates into the broader mechanism of intrinsic immunity specifically targeting viral genomes for mutation. The protein also intersects with pathways connected to nucleic acid processing. Related proteins in these immunity pathways include APOBEC3G and APOBEC3F which similarly act to induce hypermutation in retroviral and other viral agents offering a collective resistance against viral propagation.

APOBEC3D has links to certain autoimmune disorders and cancer. The activity of APOBEC3D like its relatives can contribute to genome hypermutation which plays a part in cancer development and progression. APOBEC3D in combination with other members like APOBEC3B contributes to mutational signatures found in various cancer types highlighting its potential role in tumorigenesis. Studies continue to investigate its impact on HIV-1 infection reinforcing its connection with the body's defense mechanisms and potential implications in disease resistance or susceptibility.

Specifications

Form

Liquid

General info

Function

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed : 16920826, PubMed : 20062055, PubMed : 21835787). Exhibits antiviral activity against HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA (PubMed : 16920826). The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Inhibits also the mobility of LTR and non-LTR retrotransposons (PubMed : 27428332).. (Microbial infection) Enhances hepatitis B virus/HBV replication by excluding restriction factors APOBEC3F and APOBEC3G from HBV capsids.

Sequence similarities

Belongs to the cytidine and deoxycytidylate deaminase family.

Product protocols

Target data

DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms (PubMed : 16920826, PubMed : 20062055, PubMed : 21835787). Exhibits antiviral activity against HIV-1. After the penetration of retroviral nucleocapsids into target cells of infection and the initiation of reverse transcription, it can induce the conversion of cytosine to uracil in the minus-sense single-strand viral DNA, leading to G-to-A hypermutations in the subsequent plus-strand viral DNA (PubMed : 16920826). The resultant detrimental levels of mutations in the proviral genome, along with a deamination-independent mechanism that works prior to the proviral integration, together exert efficient antiretroviral effects in infected target cells. Selectively targets single-stranded DNA and does not deaminate double-stranded DNA or single- or double-stranded RNA. Inhibits also the mobility of LTR and non-LTR retrotransposons (PubMed : 27428332).. (Microbial infection) Enhances hepatitis B virus/HBV replication by excluding restriction factors APOBEC3F and APOBEC3G from HBV capsids.
See full target information APOBEC3D

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com