JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152817

Recombinant Human ApoER2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ApoER2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 83 to 170 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

APOER2, LRP8, Low-density lipoprotein receptor-related protein 8, LRP-8, Apolipoprotein E receptor 2

1 Images
SDS-PAGE - Recombinant Human ApoER2 protein (GST tag N-Terminus) (AB152817)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ApoER2 protein (GST tag N-Terminus) (AB152817)

12.5% SDS-PAGE analysis of ab152817 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q14114

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEATCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATLCAPH","proteinLength":"Fragment","predictedMolecularWeight":"35.42 kDa","actualMolecularWeight":null,"aminoAcidEnd":170,"aminoAcidStart":83,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q14114","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ApoER2 also known as apolipoprotein E receptor 2 or LRP8 is a member of the LDL receptor family weighing about 130 kDa. It is expressed mainly in the brain but also in the heart and other tissues. This receptor interacts with extracellular binding partners such as lipoproteins and reelin to mediate signal transduction across cell membranes. ApoER2 plays an important role in brain development and synaptic plasticity through these interactions.
Biological function summary

ApoER2 contributes to neural processes like synaptic transmission and neuronal migration. It forms part of a protein complex with reelin a process essential for dendritic spine development and long-term potentiation. Its involvement in transporting cholesterol and other lipids is critical for maintaining neuronal function and integrity.

Pathways

ApoER2 participates in the reelin signaling pathway which is important for brain layer formation during development. It also interacts with other proteins like Disabled-1 (Dab1) to propagate signals initiated by reelin binding. This pathway also links ApoER2 to the regulation of synaptic strength and plasticity which are significant in learning and memory processes.

ApoER2 has connections to Alzheimer's disease and schizophrenia. Its interaction with amyloid-beta precursor protein (APP) in Alzheimer's disease impacts plaque formation and neuronal cell loss. In schizophrenia altered reelin-ApoER2 signaling can disrupt synaptic functions suggesting its involvement in the disorder's pathophysiology. Understanding these interactions may offer insights into potential therapeutic interventions.

Specifications

Form

Liquid

General info

Function

Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands (PubMed : 12899622, PubMed : 12950167, PubMed : 20223215, PubMed : 30873003). LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail (By similarity). Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons (By similarity). LRP8 has higher affinity for Reelin than VLDLR (By similarity). LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development (By similarity). Binds the endoplasmic reticulum resident receptor-associated protein (RAP) (By similarity). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature (PubMed : 12807892). Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation (By similarity). May also function as an endocytic receptor (By similarity). Not required for endocytic uptake of SEPP1 in the kidney which is mediated by LRP2 (By similarity). Together with its ligand, apolipoprotein E (apoE), may indirectly play a role in the suppression of the innate immune response by controlling the survival of myeloid-derived suppressor cells (By similarity).. (Microbial infection) Acts as a receptor for Semliki Forest virus.. (Microbial infection) Acts as a receptor for tick-borne encephalitis virus by mediating viral cell attachment and internalization.

Sequence similarities

Belongs to the LDLR family.

Post-translational modifications

O-glycosylated. Some alternatively spliced isoforms lack the O-linked sugar domain (By similarity).. Undergoes sequential, furin and gamma-secretase dependent, proteolytic processing, resulting in the extracellular release of the entire ligand-binding domain as a soluble polypeptide and in the intracellular domain (ICD) release into the cytoplasm. The gamma-secretase-dependent proteolytical processing occurs after the bulk of the extracellular domain has been shed, in a furin-dependent manner, in alternatively spliced isoforms carrying the furin cleavage site. Hypoglycosylation (mainly hypo-O-glycosylation) leads to increased extracellular cleavage, which in turn results in accelerating release of the intracellular domain (ICD) by the gamma-secretase. The resulting receptor fragment is able to inhibit Reelin signaling and in particular the Reelin-induced DAB1 phosphorylation (By similarity).. Tyrosine phosphorylated upon apoE binding.. Ubiquitinated by MYLIP leading to degradation.

Product protocols

Target data

Cell surface receptor for Reelin (RELN) and apolipoprotein E (apoE)-containing ligands (PubMed : 12899622, PubMed : 12950167, PubMed : 20223215, PubMed : 30873003). LRP8 participates in transmitting the extracellular Reelin signal to intracellular signaling processes, by binding to DAB1 on its cytoplasmic tail (By similarity). Reelin acts via both the VLDL receptor (VLDLR) and LRP8 to regulate DAB1 tyrosine phosphorylation and microtubule function in neurons (By similarity). LRP8 has higher affinity for Reelin than VLDLR (By similarity). LRP8 is thus a key component of the Reelin pathway which governs neuronal layering of the forebrain during embryonic brain development (By similarity). Binds the endoplasmic reticulum resident receptor-associated protein (RAP) (By similarity). Binds dimers of beta 2-glycoprotein I and may be involved in the suppression of platelet aggregation in the vasculature (PubMed : 12807892). Highly expressed in the initial segment of the epididymis, where it affects the functional expression of clusterin and phospholipid hydroperoxide glutathione peroxidase (PHGPx), two proteins required for sperm maturation (By similarity). May also function as an endocytic receptor (By similarity). Not required for endocytic uptake of SEPP1 in the kidney which is mediated by LRP2 (By similarity). Together with its ligand, apolipoprotein E (apoE), may indirectly play a role in the suppression of the innate immune response by controlling the survival of myeloid-derived suppressor cells (By similarity).. (Microbial infection) Acts as a receptor for Semliki Forest virus.. (Microbial infection) Acts as a receptor for tick-borne encephalitis virus by mediating viral cell attachment and internalization.
See full target information LRP8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com