JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225647

Recombinant Human Aquaporin 1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Aquaporin 1 protein (Tagged) is a Human Fragment protein, in the 220 to 269 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

CHIP28, AQP1, Aquaporin-1, AQP-1, Aquaporin-CHIP, Channel-like integral membrane protein of 28 kDa, Urine water channel

1 Images
SDS-PAGE - Recombinant Human Aquaporin 1 protein (Tagged) (AB225647)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Aquaporin 1 protein (Tagged) (AB225647)

Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P29972

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 2.9% Sodium chloride, 0.24% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK","proteinLength":"Fragment","predictedMolecularWeight":"21.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":269,"aminoAcidStart":220,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P29972","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Aquaporin 1 also known as Aquaporin-1 AQP-1 or AQP1 is a protein that functions as a water channel facilitating the transport of water across cell membranes. This protein plays an important role in maintaining water homeostasis within cells. Aquaporin 1 has a mass of approximately 28 kDa and is encoded by the AQP1 gene. It is expressed in various tissues and organs including the kidneys lungs and red blood cells indicating its importance in diverse physiological processes.
Biological function summary

Aquaporin 1 is not part of a complex but independently contributes to maintaining osmotic balance and fluid movement across epithelial and endothelial tissues. The protein's selective permeability for water without allowing ions or other solutes highlights its specificity in controlling water transport which is essential for maintaining cellular environment stability.

Pathways

The aquaporin protein is involved in key biological pathways such as the osmoregulatory pathway and the fluid secretion pathway. It maintains efficient water transport in processes like urine concentration in the kidneys and fluid regulation in the pulmonary system. Aquaporins in general are related to similar transport proteins like sodium channels which together play an important role in maintaining osmotic balance across various tissues.

Aquaporin 1's dysfunction has been associated with conditions such as nephrogenic diabetes insipidus and pulmonary edema. These are linked to its role in water reabsorption in the kidneys and fluid balance in the lungs. The disorder's connection ties Aquaporin-1 with other regulatory proteins such as vasopressin receptors which work in conjunction to control renal water reabsorption and response to fluid imbalance.

Specifications

Form

Lyophilized

General info

Function

Forms a water channel that facilitates the transport of water across cell membranes, playing a crucial role in water homeostasis in various tissues (PubMed : 1373524, PubMed : 23219802). Could also be permeable to small solutes including hydrogen peroxide, glycerol and gases such as amonnia (NH3), nitric oxide (NO) and carbon dioxide (CO2) (PubMed : 16682607, PubMed : 17012249, PubMed : 19273840, PubMed : 33028705, PubMed : 8584435). Recruited to the ankyrin-1 complex, a multiprotein complex of the erythrocyte membrane, it could be part of a CO2 metabolon, linking facilitated diffusion of CO2 across the membrane, anion exchange of Cl(-)/HCO3(-) and interconversion of dissolved CO2 and carbonic acid in the cytosol (PubMed : 17012249, PubMed : 35835865). In vitro, it shows non-selective gated cation channel activity and may be permeable to cations like K(+) and Na(+) in vivo (PubMed : 36949749, PubMed : 8703053).

Sequence similarities

Belongs to the MIP/aquaporin (TC 1.A.8) family.

Product protocols

Target data

Forms a water channel that facilitates the transport of water across cell membranes, playing a crucial role in water homeostasis in various tissues (PubMed : 1373524, PubMed : 23219802). Could also be permeable to small solutes including hydrogen peroxide, glycerol and gases such as amonnia (NH3), nitric oxide (NO) and carbon dioxide (CO2) (PubMed : 16682607, PubMed : 17012249, PubMed : 19273840, PubMed : 33028705, PubMed : 8584435). Recruited to the ankyrin-1 complex, a multiprotein complex of the erythrocyte membrane, it could be part of a CO2 metabolon, linking facilitated diffusion of CO2 across the membrane, anion exchange of Cl(-)/HCO3(-) and interconversion of dissolved CO2 and carbonic acid in the cytosol (PubMed : 17012249, PubMed : 35835865). In vitro, it shows non-selective gated cation channel activity and may be permeable to cations like K(+) and Na(+) in vivo (PubMed : 36949749, PubMed : 8703053).
See full target information AQP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com