JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB225651

Recombinant Human Aquaporin 4 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Aquaporin 4 protein (Tagged) is a Human Fragment protein, in the 253 to 323 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Aquaporin-4, AQP-4, Mercurial-insensitive water channel, WCH4, MIWC, AQP4

1 Images
SDS-PAGE - Recombinant Human Aquaporin 4 protein (Tagged) (AB225651)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Aquaporin 4 protein (Tagged) (AB225651)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225651 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

6x His tag N-Terminus SUMO tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P55087

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV","proteinLength":"Fragment","predictedMolecularWeight":"24 kDa","actualMolecularWeight":null,"aminoAcidEnd":323,"aminoAcidStart":253,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P55087","tags":[{"tag":"6x His","terminus":"N-Terminus"},{"tag":"SUMO","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Aquaporin 4 also known as AQP4 functions as a water channel protein that facilitates the transport of water across cell membranes. It is composed of approximately 323 amino acids resulting in a molecular mass of around 34-38 kDa. This target expresses most in the central nervous system especially in the astrocytes of the brain and spinal cord. Other expression sites include skeletal muscle kidneys and lungs. AQP4 is often studied using various tools including anti-aquaporin 4 antibodies and specific reagents like AQP4 Ab and anti-AQP4.
Biological function summary

Water balance and neural activity regulation are significantly influenced by aquaporin 4. This protein forms a part of the orthogonal array of particles (OAPs) in the plasma membrane which enhances its water permeability function. Through its concentration at the blood-brain barrier AQP4 contributes to maintaining brain homeostasis by regulating osmotic gradients and extracellular space ion concentrations. Its expression and activity may affect critical processes like neuroexcitation and neuroprotection.

Pathways

Aquaporin 4 actively engages in critical water transport and blood-brain barrier integrity pathways. The passive yet selective water transport facilitated by AQP4 impacts pathways including the transcellular pathway that helps in maintaining the homeostatic and osmotic balance important for brain function. Furthermore AQP4 acts in relation to other proteins such as aquaporin 1 and connexin 43 indicating its role in gap junction communication within the brain.

Aquaporin 4 is intricately linked to conditions like neuromyelitis optica (NMO) and cerebral edema. In NMO autoantibodies such as anti-AQP4 target the protein causing demyelination and inflammation of the optic nerve and spinal cord. In cases of cerebral edema an imbalance in AQP4 expression can disrupt water homeostasis leading to exacerbated swelling. AQP4's interaction with proteins like myelin basic protein in these diseases underlines its significance in neurodegeneration and inflammatory processes.

Specifications

Form

Liquid

General info

Function

Forms a water-specific channel (PubMed : 19383790, PubMed : 7559426, PubMed : 8601457). Plays an important role in brain water homeostasis (PubMed : 37143309). It is involved in glymphatic solute transport and is required for a normal rate of water exchange across the blood brain interface. Required for normal levels of cerebrospinal fluid influx into the brain cortex and parenchyma along paravascular spaces that surround penetrating arteries, and for normal drainage of interstitial fluid along paravenous drainage pathways. Thereby, it is required for normal clearance of solutes from the brain interstitial fluid, including soluble beta-amyloid peptides derived from APP. Plays a redundant role in urinary water homeostasis and urinary concentrating ability (By similarity).

Sequence similarities

Belongs to the MIP/aquaporin (TC 1.A.8) family.

Post-translational modifications

Phosphorylation by PKC at Ser-180 reduces conductance by 50%. Phosphorylation by PKG at Ser-111 in response to glutamate increases conductance by 40% (By similarity).. Isoform 2: Palmitoylated on its N-terminal region. Isoform 1: Not palmitoylated.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Forms a water-specific channel (PubMed : 19383790, PubMed : 7559426, PubMed : 8601457). Plays an important role in brain water homeostasis (PubMed : 37143309). It is involved in glymphatic solute transport and is required for a normal rate of water exchange across the blood brain interface. Required for normal levels of cerebrospinal fluid influx into the brain cortex and parenchyma along paravascular spaces that surround penetrating arteries, and for normal drainage of interstitial fluid along paravenous drainage pathways. Thereby, it is required for normal clearance of solutes from the brain interstitial fluid, including soluble beta-amyloid peptides derived from APP. Plays a redundant role in urinary water homeostasis and urinary concentrating ability (By similarity).
See full target information AQP4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com