JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB235860

Recombinant Human ARF1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ARF1 protein (Tagged) is a Human Full Length protein, in the 2 to 181 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

ADP-ribosylation factor 1, ARF1

1 Images
SDS-PAGE - Recombinant Human ARF1 protein (Tagged) (AB235860)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ARF1 protein (Tagged) (AB235860)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab235860.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P84077

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK","proteinLength":"Full Length","predictedMolecularWeight":"21 kDa","actualMolecularWeight":null,"aminoAcidEnd":181,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P84077","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ARF1 also known as ADP-ribosylation factor 1 or ARF1 protein is a small GTPase with a molecular mass of approximately 20 kDa. Commonly expressed in a variety of cell types ARF1 plays a central role in vesicle trafficking. As an activator ARF1 interacts with different GTPase-activating proteins such as ARFGAP1 and BIG1 ensuring the proper distribution of proteins and lipids in cells. ARF1's expression occurs across numerous cellular compartments including the Golgi apparatus aiding in the formation of transport vesicles.
Biological function summary

ARF1 is essential in regulating membrane dynamics and vesicular traffic. It forms part of the COPI and clathrin-coated vesicle complexes where it recruits coat proteins to budding vesicles. This recruitment is fundamental for maintaining Golgi structure and function. Additionally ARF1 plays a role in cytokinesis by interacting with the septin cytoskeleton. The protein also influences actin cytoskeleton remodeling which is pivotal for cell shape changes and motility.

Pathways

ARF1 is central to both the endocytic and secretory pathways. It collaborates with proteins like ARFS and 3F1 in modulating the trafficking of cargo between the endoplasmic reticulum and Golgi. Within the secretory pathway ARF1 interacts with SNARE proteins to facilitate vesicle docking and fusion. Its actions in pathways maintain cellular homeostasis and promote proper cellular response to various stimuli.

ARF1 has links to cancer and Alzheimer's disease. Overexpression of ARF1 correlates with tumor progression and metastasis impacting cell proliferation and survival mechanisms. Additionally its disruption associates with Alzheimer's where it may influence amyloid precursor protein processing alongside interactions with GAP proteins. Understanding ARF1's role in these conditions highlights its potential as a therapeutic target stressing the importance of studying its interactions with disease-related proteins.

Specifications

Form

Liquid

General info

Function

Small GTPase involved in protein trafficking between different compartments (PubMed : 8253837). Modulates vesicle budding and uncoating within the Golgi complex (PubMed : 8253837). In its GTP-bound form, triggers the recruitment of coatomer proteins to the Golgi membrane (PubMed : 8253837). The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles (PubMed : 8253837). The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasticity of excitatory synapses and spine shrinkage during long-term depression (LTD) (By similarity). Plays a key role in the regulation of intestinal stem cells and gut microbiota, and is essential for maintaining intestinal homeostasis (By similarity). Plays also a critical role in mast cell expansion but not in mast cell maturation by facilitating optimal mTORC1 activation (By similarity).. (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.

Sequence similarities

Belongs to the small GTPase superfamily. Arf family.

Post-translational modifications

(Microbial infection) Demyristoylated by S.flexneri cysteine protease IpaJ which cleaves the peptide bond between N-myristoylated Gly-2 and Asn-3.

Product protocols

Target data

Small GTPase involved in protein trafficking between different compartments (PubMed : 8253837). Modulates vesicle budding and uncoating within the Golgi complex (PubMed : 8253837). In its GTP-bound form, triggers the recruitment of coatomer proteins to the Golgi membrane (PubMed : 8253837). The hydrolysis of ARF1-bound GTP, which is mediated by ARFGAPs proteins, is required for dissociation of coat proteins from Golgi membranes and vesicles (PubMed : 8253837). The GTP-bound form interacts with PICK1 to limit PICK1-mediated inhibition of Arp2/3 complex activity; the function is linked to AMPA receptor (AMPAR) trafficking, regulation of synaptic plasticity of excitatory synapses and spine shrinkage during long-term depression (LTD) (By similarity). Plays a key role in the regulation of intestinal stem cells and gut microbiota, and is essential for maintaining intestinal homeostasis (By similarity). Plays also a critical role in mast cell expansion but not in mast cell maturation by facilitating optimal mTORC1 activation (By similarity).. (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
See full target information ARF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com