JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB102025

Recombinant Human ARF6 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ARF6 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 175 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

ADP-ribosylation factor 6, ARF6

1 Images
SDS-PAGE - Recombinant Human ARF6 protein (His tag N-Terminus) (AB102025)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ARF6 protein (His tag N-Terminus) (AB102025)

15% SDS-PAGE analysis of ab102025 (3μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

P62330

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0308% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.00348% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS","proteinLength":"Full Length","predictedMolecularWeight":"22.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":175,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P62330","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The ARF6 protein also known as ADP-ribosylation factor 6 is a small GTPase with a molecular weight of approximately 21 kDa. The protein belongs to the ARF family which plays roles in regulating vesicular trafficking and cytoskeletal dynamics. ARF6 is ubiquitously expressed across many tissues most abundantly in the brain muscle and epithelial cells. Its activity depends on cycling between an inactive GDP-bound form and an active GTP-bound form which is important for its function in cellular processes.
Biological function summary

The activity of ARF6 influences membrane trafficking and actin cytoskeleton remodeling. The protein helps mediate endocytosis and exocytosis as well as modulating cell adhesion and migration. ARF6 interacts with various effector proteins to form a complex that is involved in the coordination of these processes. This complex activity underlines ARF6's roles in cell signaling and intracellular trafficking mechanisms.

Pathways

ARF6 plays key roles in the Wnt signaling pathway and the E-cadherin recycling pathway. In the Wnt pathway ARF6 regulates the internalization of receptors and affects downstream signaling. In E-cadherin recycling ARF6 orchestrates trafficking events that ensure proper cell-cell adhesion. These functions often involve interactions with related proteins like ARF1 and Rac1 which further modulate ARF6's involvement in these signaling events influencing cellular behavior.

ARF6 has a connection to certain cancers and neurological conditions. Its dysregulation can lead to increased metastasis in cancers partly due to altered cell motility and invasion linked to changes in cell adhesion. Additionally the misregulation of ARF6 is implicated in Alzheimer's disease where it may disrupt neuronal trafficking and contribute to synaptic dysfunction. These disease associations also involve related proteins such as EFA6 and ARHGAP10 which can modulate ARF6 activity and its effects on pathological processes.

Specifications

Form

Liquid

Additional notes

ab102025 was purified using conventional chromatography techniques.

General info

Function

GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling (PubMed : 11266366, PubMed : 16737952, PubMed : 18400762, PubMed : 21170023, PubMed : 32103017, PubMed : 7589240). GTP-bound form plays an important role in the transport of multiple palmitoylated proteins form the Golgi to the plasma membrane (PubMed : 37461827). Required for normal completion of mitotic cytokinesis (By similarity). Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers (By similarity). Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension (PubMed : 14978216). Potentiates the neurite outgrowth in primary neurons by interacting with the molecular adapter APBB1 (PubMed : 36250347). Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization (PubMed : 36017701). Regulates surface levels of adherens junction proteins such as CDH1 (By similarity). Required for NTRK1 sorting to the recycling pathway from early endosomes (By similarity).. (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.. (Microbial infection) Plays a key role in the endocytosis of enterovirus 71 and thus viral entry into brain microvascular endothelial cells.

Sequence similarities

Belongs to the small GTPase superfamily. Arf family.

Post-translational modifications

GTP-bound form is myristoylated on Lys-3 by NMT1 and NMT2, allowing ARF6 to remain on membranes during the GTPase cycle, thereby promoting its activity (PubMed:32103017). GDP-bound inactive form is demyristoylated on Lys-3 by SIRT2 at early endosomes or endocytic recycling compartment to allow its efficient activation by a guanine exchange factor (GEF) after GDP release (PubMed:32103017).

Subcellular localisation

Endosome membrane

Product protocols

Target data

GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling (PubMed : 11266366, PubMed : 16737952, PubMed : 18400762, PubMed : 21170023, PubMed : 32103017, PubMed : 7589240). GTP-bound form plays an important role in the transport of multiple palmitoylated proteins form the Golgi to the plasma membrane (PubMed : 37461827). Required for normal completion of mitotic cytokinesis (By similarity). Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers (By similarity). Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension (PubMed : 14978216). Potentiates the neurite outgrowth in primary neurons by interacting with the molecular adapter APBB1 (PubMed : 36250347). Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization (PubMed : 36017701). Regulates surface levels of adherens junction proteins such as CDH1 (By similarity). Required for NTRK1 sorting to the recycling pathway from early endosomes (By similarity).. (Microbial infection) Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.. (Microbial infection) Plays a key role in the endocytosis of enterovirus 71 and thus viral entry into brain microvascular endothelial cells.
See full target information ADP-ribosylation factor 6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com