JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152847

Recombinant Human ARID1A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ARID1A protein is a Human Fragment protein, in the 1216 to 1325 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

BAF250, BAF250A, C1orf4, OSA1, SMARCF1, ARID1A, AT-rich interactive domain-containing protein 1A, ARID domain-containing protein 1A, B120, BRG1-associated factor 250, BRG1-associated factor 250a, Osa homolog 1, SWI-like protein, SWI/SNF complex protein p270, hELD, hOSA1

1 Images
SDS-PAGE - Recombinant Human ARID1A protein (AB152847)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ARID1A protein (AB152847)

12.5% SDS-PAGE analysis of ab152847 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

O14497

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP","proteinLength":"Fragment","predictedMolecularWeight":"37.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":1325,"aminoAcidStart":1216,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O14497","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ARID1A also known as BAF250A is a protein encoded by the ARID1A gene and forms part of the SWI/SNF chromatin remodeling complex. The molecular weight of ARID1A is approximately 270 kDa. This protein is expressed in many tissues but higher expression is noted in the liver kidney and placenta. ARID1A contains an ARID (A-T Rich Interaction Domain) which allows it to bind DNA influencing transcription regulation significantly.
Biological function summary

ARID1A impacts cellular functions through its role in the SWI/SNF complex. This complex modulates chromatin structure and is integral to DNA accessibility which in turn controls gene expression. ARID1A's involvement helps in regulating transcription factors and affects processes such as cell growth and differentiation. Its function is necessary for maintaining proper cell proliferation and apoptosis balance.

Pathways

ARID1A plays a central role in transcriptional regulation and cell cycle control. It shows interaction with the tumor suppressor protein p53 and is implicated in the PI3K/AKT signaling pathway. ARID1A's function in these pathways affects cellular responses to DNA damage and growth signals linking it closely to important cellular fate decisions.

Mutations or loss of function in ARID1A has been strongly associated with various cancers including ovarian and endometrial cancers. In these contexts ARID1A dysfunction often occurs alongside other proteins such as p53 contributing to tumorigenesis by deregulating tumor suppressive pathways. It also holds a potential connection to neurodevelopmental disorders due to its role in chromatin remodeling and gene expression.

Specifications

Form

Liquid

General info

Function

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).

Subcellular localisation

Nucleus

Product protocols

Target data

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).
See full target information ARID1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com