JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB108125

Recombinant Human ARL6 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ARL6 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 186 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

BBS3, ARL6, ADP-ribosylation factor-like protein 6, Bardet-Biedl syndrome 3 protein

1 Images
SDS-PAGE - Recombinant Human ARL6 protein (His tag N-Terminus) (AB108125)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ARL6 protein (His tag N-Terminus) (AB108125)

15% SDS-PAGE analysis of ab108125 (3µg) at approximately 23.2 kDa.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9H0F7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICMGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMASDAIKGEGLQEGVDWLQDQIQTVKT","proteinLength":"Full Length","predictedMolecularWeight":"23.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":186,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9H0F7","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ARL6 also known as ADP-ribosylation factor-like protein 6 is a small GTPase with a molecular weight of approximately 21 kDa. It belongs to the ARF family involved in signal transduction and membrane trafficking. Researchers observe its expression in various tissues with high expression in the brain retina and testis. Its primary role involves the regulation of intracellular vesicular transport and ciliary function as ARL6 is essential in the formation and maintenance of cilia.
Biological function summary

ARL6 participates in the regulation of ciliary membrane composition by controlling the trafficking of cargo proteins to the cilia. It acts independently and also forms part of a protein complex associated with the BBSome instrumental in mediating the recruitment of proteins to the ciliary membrane. This complex is central to maintaining ciliary function and signaling key for photoreceptor cell function in the retina and cellular transport mechanisms in other tissues.

Pathways

ARL6 functions in the regulation of the ciliary trafficking pathway important for cellular signaling and transport. ARL6 is closely linked with proteins such as BBS1 and BBS5 within the BBSome complex facilitating the movement of vesicles to and from the cilium. It also influences the Wnt signaling pathway significant in developmental processes where it interacts with other GTPases and signaling proteins to mediate cellular responses through modulating ciliary dynamics.

Mutations in ARL6 are linked to Bardet-Biedl syndrome a ciliopathy characterized by retinal degeneration obesity and renal abnormalities. This connection highlights ARL6's involvement in ciliary function and integrity. Researchers find that its interactions with BBS4 and BBS8 both part of the BBSome complex are important in these pathophysiological processes. Additionally abnormalities in ARL6 function have associations with retinal dystrophies where perturbations in its role in cilia can lead to defects in photoreceptor cell maintenance and function.

Specifications

Form

Liquid

Additional notes

Purified using conventional chromatography.

General info

Function

Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia (PubMed : 20603001). Together with BBS1, is necessary for correct trafficking of PKD1 to primary cilia (By similarity). Together with the BBSome complex and LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation (PubMed : 22072986). May regulate cilia assembly and disassembly and subsequent ciliary signaling events such as the Wnt signaling cascade (PubMed : 20207729). Isoform 2 may be required for proper retinal function and organization (By similarity).

Sequence similarities

Belongs to the small GTPase superfamily. Arf family.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Involved in membrane protein trafficking at the base of the ciliary organelle. Mediates recruitment onto plasma membrane of the BBSome complex which would constitute a coat complex required for sorting of specific membrane proteins to the primary cilia (PubMed : 20603001). Together with BBS1, is necessary for correct trafficking of PKD1 to primary cilia (By similarity). Together with the BBSome complex and LTZL1, controls SMO ciliary trafficking and contributes to the sonic hedgehog (SHH) pathway regulation (PubMed : 22072986). May regulate cilia assembly and disassembly and subsequent ciliary signaling events such as the Wnt signaling cascade (PubMed : 20207729). Isoform 2 may be required for proper retinal function and organization (By similarity).
See full target information ARL6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com