JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114948

Recombinant Human ASAH1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ASAH1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 25 to 124 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ASAH, HSD-33, HSD33, ASAH1, Acid ceramidase, AC, ACDase, Acid CDase, Acylsphingosine deacylase, Glycosylceramide deacylase, N-acylethanolamine hydrolase ASAH1, N-acylsphingosine amidohydrolase, Putative 32 kDa heart protein, PHP32

1 Images
SDS-PAGE - Recombinant Human ASAH1 protein (GST tag N-Terminus) (AB114948)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ASAH1 protein (GST tag N-Terminus) (AB114948)

12.5% SDS-PAGE showing ab114948 at approximately 36.63kDa.
Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

Q13510

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein.</p>" } } }

Product details

Protein concentration is above or equal to 0.05 mg/ml.
Best used within three months from the date of receipt.

Sequence info

[{"sequence":"PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":124,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q13510","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ASAH1 also known as acid ceramidase or alkaline ceramidase is an enzyme that plays a role in the hydrolysis of ceramides into sphingosine and free fatty acids. It has a mass of approximately 55 kDa. This enzyme is primarily found in lysosomes cellular organelles that manage waste. ASAH1 is expressed in various tissues including liver heart brain and skin illustrating its widespread distribution in the body.
Biological function summary

ASAH1 influences several important cellular processes by controlling the levels of ceramide and sphingosine. These lipids are not just structural components of membranes; they participate actively in cell signaling. ASAH1 exists as part of a larger complex that includes other enzymes involved in sphingolipid metabolism. Changes in ceramide levels influence apoptosis and cell proliferation indicating ASAH1's role as a regulator in these processes.

Pathways

ASAH1 is central to the sphingolipid metabolism pathway. This pathway is interconnected with the apoptosis signaling pathway. By converting ceramide to sphingosine ASAH1 links the complex ceramide/sphingosine balance affecting cell survival and death decisions. It interacts with other enzymes such as sphingosine kinase 1 and ceramide synthases which further maintain the dynamic regulation between sphingosine and ceramide levels.

ASAH1 is linked to conditions such as Farber disease and spinal muscular atrophy. These disorders result from dysfunctional ceramide metabolism causing cellular and systemic impacts due to excessive ceramide accumulation. Proteins like acid sphingomyelinase are related to ASAH1's role in these diseases as both contribute to sphingolipid balance in cells. Understanding ASAH1 and its pathways provides insights into potential therapeutic targets for these sphingolipid-related disorders.

Specifications

Form

Liquid

General info

Function

Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH (PubMed : 10610716, PubMed : 11451951, PubMed : 15655246, PubMed : 26898341, PubMed : 36752535, PubMed : 7744740, PubMed : 7852294). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed : 10610716). Has a higher catalytic efficiency towards C12-ceramides versus other ceramides (PubMed : 15655246, PubMed : 7744740). Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine (PubMed : 12764132, PubMed : 12815059). For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used (PubMed : 12764132). Also has an N-acylethanolamine hydrolase activity (PubMed : 15655246). By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes (PubMed : 17713573). Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis (By similarity). By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis (PubMed : 22261821).. Isoform 2. May directly regulate steroidogenesis by binding the nuclear receptor NR5A1 and negatively regulating its transcriptional activity.

Sequence similarities

Belongs to the acid ceramidase family.

Post-translational modifications

N-glycosylated.. Proteolytically cleaved into two chains alpha and beta that remain associated via a disulfide bond (PubMed:11451951, PubMed:29692406, PubMed:30525581, PubMed:7744740). Cleavage gives rise to a conformation change that activates the enzyme. The same catalytic Cys residue mediates the autoproteolytic cleavage and subsequent hydrolysis of lipid substrates (PubMed:29692406, PubMed:30525581). The beta chain may undergo an additional C-terminal processing (PubMed:12815059).

Product protocols

Target data

Lysosomal ceramidase that hydrolyzes sphingolipid ceramides into sphingosine and free fatty acids at acidic pH (PubMed : 10610716, PubMed : 11451951, PubMed : 15655246, PubMed : 26898341, PubMed : 36752535, PubMed : 7744740, PubMed : 7852294). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed : 10610716). Has a higher catalytic efficiency towards C12-ceramides versus other ceramides (PubMed : 15655246, PubMed : 7744740). Also catalyzes the reverse reaction allowing the synthesis of ceramides from fatty acids and sphingosine (PubMed : 12764132, PubMed : 12815059). For the reverse synthetic reaction, the natural sphingosine D-erythro isomer is more efficiently utilized as a substrate compared to D-erythro-dihydrosphingosine and D-erythro-phytosphingosine, while the fatty acids with chain lengths of 12 or 14 carbons are the most efficiently used (PubMed : 12764132). Also has an N-acylethanolamine hydrolase activity (PubMed : 15655246). By regulating the levels of ceramides, sphingosine and sphingosine-1-phosphate in the epidermis, mediates the calcium-induced differentiation of epidermal keratinocytes (PubMed : 17713573). Also indirectly regulates tumor necrosis factor/TNF-induced apoptosis (By similarity). By regulating the intracellular balance between ceramides and sphingosine, in adrenocortical cells, probably also acts as a regulator of steroidogenesis (PubMed : 22261821).. Isoform 2. May directly regulate steroidogenesis by binding the nuclear receptor NR5A1 and negatively regulating its transcriptional activity.
See full target information ASAH1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com