JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB130033

Recombinant Human ASF1b protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human ASF1b protein (His tag C-Terminus) is a Human Full Length protein, in the 1 to 202 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Histone chaperone ASF1B, Anti-silencing function protein 1 homolog B, CCG1-interacting factor A-II, hAsf1, hAsf1b, CIA-II, hCIA-II, ASF1B

1 Images
SDS-PAGE - Recombinant Human ASF1b protein (His tag C-Terminus) (AB130033)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ASF1b protein (His tag C-Terminus) (AB130033)

ab130033 at 3 μg analysed by 15% SDS-PAGE.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q9NVP2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCILEHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"23.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":202,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NVP2","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ASF1b also known as Anti-Silencing Function 1B is a histone chaperone that weighs approximately 22 kDa. This protein is part of the histone fold family facilitating the transfer of histone H3/H4 dimers either into histone octamers or back to the nucleosome. ASF1b is expressed in various human tissues with significant expression in proliferating cells. Its unique ability to influence chromatin assembly positions it as an important player within cellular dynamics.
Biological function summary

The protein assists in the maintenance and regulation of chromatin structure impacting DNA replication and transcription. ASF1b interacts with histone H3/H4 complexes and often works in coordination with CAF-1 forming a multi-protein complex important for nucleosome assembly during DNA replication. Through these interactions ASF1b plays a role in both maintaining genomic stability and facilitating proper cell cycle progression.

Pathways

ASF1b contributes to the DNA replication and repair pathways required for accurate duplication of genetic material. In the DNA damage response ASF1b offers histone supply critical for chromatin structure restoration post-repair. It also interacts with proteins like ATR and CHK1 aiding in the checkpoint response to DNA damage to prevent genomic instability. However its precise regulation within these pathways can have significant cellular consequences related to genome integrity.

The aberrant expression of ASF1b has links to cancer progression most notably in breast and prostate cancers. Overexpression can drive unchecked cell proliferation correlating with aggressive cancer phenotypes. ASF1b's association with oncogenic pathways involves partner proteins such as p53 where ASF1b indirectly influences its tumor suppressor pathway through modulation of chromatin dynamics showcasing its fundamental role in both normal and pathological cell processes.

Specifications

Form

Liquid

Additional notes

ab130033 was purified by using conventional chromatography techniques.

General info

Function

Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251, PubMed : 21454524, PubMed : 26527279). Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251). Also involved in the nuclear import of the histone H3-H4 dimer together with importin-4 (IPO4) : specifically recognizes and binds newly synthesized histones with the monomethylation of H3 'Lys-9' (H3K9me1) and diacetylation at 'Lys-5' and 'Lys-12' of H4 (H4K5K12ac) marks in the cytosol (PubMed : 20953179, PubMed : 21454524, PubMed : 26527279). Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251). Required for gonad development (PubMed : 12842904).

Sequence similarities

Belongs to the ASF1 family.

Post-translational modifications

Phosphorylated by TLK1 and TLK2.

Subcellular localisation

Nucleus

Product protocols

Target data

Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251, PubMed : 21454524, PubMed : 26527279). Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251). Also involved in the nuclear import of the histone H3-H4 dimer together with importin-4 (IPO4) : specifically recognizes and binds newly synthesized histones with the monomethylation of H3 'Lys-9' (H3K9me1) and diacetylation at 'Lys-5' and 'Lys-12' of H4 (H4K5K12ac) marks in the cytosol (PubMed : 20953179, PubMed : 21454524, PubMed : 26527279). Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA (PubMed : 11897662, PubMed : 14718166, PubMed : 15664198, PubMed : 16151251). Required for gonad development (PubMed : 12842904).
See full target information ASF1B

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Molecular cell 83:1075-1092.e9 PubMed36868228

2023

DAXX adds a de novo H3.3K9me3 deposition pathway to the histone chaperone network.

Applications

Unspecified application

Species

Unspecified reactive species

Massimo Carraro,Ivo A Hendriks,Colin M Hammond,Victor Solis-Mezarino,Moritz Völker-Albert,Jonas D Elsborg,Melanie B Weisser,Christos Spanos,Guillermo Montoya,Juri Rappsilber,Axel Imhof,Michael L Nielsen,Anja Groth
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com