JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB185833

Recombinant Human ASXL1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ASXL1 protein is a Human Fragment protein, in the 1477 to 1541 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

KIAA0978, ASXL1, Polycomb group protein ASXL1, Additional sex combs-like protein 1

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Q8IXJ9

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 3X PBS

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR","proteinLength":"Fragment","predictedMolecularWeight":"34 kDa","actualMolecularWeight":null,"aminoAcidEnd":1541,"aminoAcidStart":1477,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q8IXJ9","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage duration
A few weeks
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ASXL1 also known as Additional Sex Combs-Like 1 functions primarily as a core component in chromatin modification processes. This protein has a molecular mass of approximately 165 kDa. ASXL1 is typically expressed in a wide range of tissues including hematopoietic cells indicating its role in diverse biological processes. The protein serves as a regulator of gene expression by influencing how tightly DNA wraps around histones allowing or restricting access to transcriptional machinery.
Biological function summary

ASXL1 plays a critical role in epigenetic regulation and is often part of polycomb repressive complexes. These complexes contribute to transcriptional repression particularly during cellular differentiation and development. ASXL1 interacts with other proteins to modify histones thereby affecting the expression of genes involved in growth and differentiation processes. Its function is closely connected to developmental pathways given its impact on regulation at the chromatin level.

Pathways

ASXL1 interacts with complex epigenetic regulatory networks. It takes part in the PRC2 (Polycomb Repressive Complex 2) pathway an essential pathway for transcriptional silencing via histone methylation. ASXL1 also shows interactions with proteins like EZH2 and SUZ12 within this pathway contributing to the methylation of histone H3 at lysine 27 (H3K27me3). Such interactions underline its role in chromatin remodeling and maintaining gene silencing during development and homeostasis.

ASXL1 mutations are frequently linked to myeloid malignancies such as myelodysplastic syndromes (MDS) and chronic myelomonocytic leukemia (CMML). These mutations often result in loss of function disrupting gene expression regulation and leading to abnormal cellular proliferation. ASXL1’s role connects with the protein RUNX1 in these conditions where impaired regulation can progress to malignancies. Researchers continue to investigate the exact mechanisms through which these interactions contribute to the pathogenesis of these disorders.

Specifications

Form

Lyophilized

Additional notes

Purity is determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG) (PubMed : 16606617). Acts as a coactivator of RARA and RXRA through association with NCOA1 (PubMed : 16606617). Acts as a corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity (By similarity). Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (PubMed : 20436459, PubMed : 30664650, PubMed : 36180891). Acts as a sensor of N(6)-methyladenine methylation on DNA (6mA) : recognizes and binds 6mA DNA, leading to its ubiquitination and degradation by TRIP12, thereby inactivating the PR-DUB complex and regulating Polycomb silencing (PubMed : 30982744). The PR-DUB complex is an epigenetic regulator of gene expression and acts as a transcriptional coactivator, affecting genes involved in development, cell communication, signaling, cell proliferation and cell viability (PubMed : 30664650, PubMed : 36180891). ASXL1, ASXL2 and ASXL3 function redundantly in the PR-DUB complex (By similarity) (PubMed : 30664650). The ASXL proteins are essential for chromatin recruitment and transcriptional activation of associated genes (By similarity). ASXL1 and ASXL2 are important for BAP1 protein stability (PubMed : 30664650). Together with BAP1, negatively regulates epithelial-mesenchymal transition (EMT) of trophoblast stem cells during placental development by regulating genes involved in epithelial cell integrity, cell adhesion and cytoskeletal organization (PubMed : 34170818).

Sequence similarities

Belongs to the Asx family.

Post-translational modifications

Ubiquitinated by TRIP12, leading to its subsequent degradation following binding of N(6)-methyladenine methylated DNA (6mA).

Subcellular localisation

Nucleus

Product protocols

Target data

Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG) (PubMed : 16606617). Acts as a coactivator of RARA and RXRA through association with NCOA1 (PubMed : 16606617). Acts as a corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity (By similarity). Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (PubMed : 20436459, PubMed : 30664650, PubMed : 36180891). Acts as a sensor of N(6)-methyladenine methylation on DNA (6mA) : recognizes and binds 6mA DNA, leading to its ubiquitination and degradation by TRIP12, thereby inactivating the PR-DUB complex and regulating Polycomb silencing (PubMed : 30982744). The PR-DUB complex is an epigenetic regulator of gene expression and acts as a transcriptional coactivator, affecting genes involved in development, cell communication, signaling, cell proliferation and cell viability (PubMed : 30664650, PubMed : 36180891). ASXL1, ASXL2 and ASXL3 function redundantly in the PR-DUB complex (By similarity) (PubMed : 30664650). The ASXL proteins are essential for chromatin recruitment and transcriptional activation of associated genes (By similarity). ASXL1 and ASXL2 are important for BAP1 protein stability (PubMed : 30664650). Together with BAP1, negatively regulates epithelial-mesenchymal transition (EMT) of trophoblast stem cells during placental development by regulating genes involved in epithelial cell integrity, cell adhesion and cytoskeletal organization (PubMed : 34170818).
See full target information ASXL1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com