JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131846

Recombinant Human ATF6 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATF6 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1 to 202 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, Activating transcription factor 6 alpha, ATF6-alpha, ATF6

1 Images
SDS-PAGE - Recombinant Human ATF6 protein (GST tag N-Terminus) (AB131846)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATF6 protein (GST tag N-Terminus) (AB131846)

12.5% SDS-PAGE stained with Coomassie Blue showing ab131846 at approximately 48.5 kDa.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P18850

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Tested in recombinant protein only.</p>" } } }

Product details

Protein concentration is above or equal to 0.05 mg/mL.

Sequence info

[{"sequence":"MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT","proteinLength":"Fragment","predictedMolecularWeight":"48.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":202,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P18850","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Activating Transcription Factor 6 (ATF6) also known as ATF 6 is a significant protein in the endoplasmic reticulum (ER) stress response. The ATF6 protein has a molecular weight of approximately 84 kDa. It expresses predominantly in the endoplasmic reticulum membrane and plays a critical role in the unfolded protein response (UPR). During ER stress ATF6 relocates to the Golgi apparatus where it undergoes cleavage to become an active transcription factor. This process helps the cell to manage the accumulation of unfolded proteins.
Biological function summary

ATF6 operates as part of the transcription regulation mechanisms responding to ER stress. The ATF6 protein is essential in managing the expression of chaperone genes and ER-associated degradation (ERAD) components thereby maintaining protein homeostasis. ATF6 itself does not operate within a traditional complex but its activation involves proteolytic cleavage which subsequently releases the active form to the nucleus where it influences gene expression to alleviate stress conditions.

Pathways

ATF6 is prominently involved in the unfolded protein response pathway which manages cell survival and stress adaptation. This pathway closely interacts with other proteins like IRE1 and PERK forming a network that modulates the transcription of UPR target genes. Additionally ATF6 contributes to checkpoint control pathways that stabilize cellular environment by regulating genes related to chaperone and protein folding.

Malfunction or dysregulation of ATF6 links to conditions like diabetes and neurodegenerative diseases. In diabetes improper ATF6 function affects insulin signaling and glucose homeostasis often alongside proteins such as XBP1. In neurodegenerative diseases an inappropriate response to ER stress influences the progression of disorders like Alzheimer's disease where protein misfolding and aggregation play pivotal roles. Understanding how ATF6 interplays with these diseases could lead to new therapeutic avenues.

Specifications

Form

Liquid

General info

Function

Cyclic AMP-dependent transcription factor ATF-6 alpha. Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 alpha), which is embedded in the endoplasmic reticulum membrane (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). Endoplasmic reticulum stress promotes processing of this form, releasing the transcription factor form that translocates into the nucleus, where it activates transcription of genes involved in the unfolded protein response (UPR) (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464).. Processed cyclic AMP-dependent transcription factor ATF-6 alpha. Transcription factor that initiates the unfolded protein response (UPR) during endoplasmic reticulum stress by activating transcription of genes involved in the UPR (PubMed : 10564271, PubMed : 11158310, PubMed : 11163209, PubMed : 11779464). Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3') (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). May play a role in foveal development and cone function in the retina (PubMed : 26029869).

Sequence similarities

Belongs to the bZIP family. ATF subfamily.

Post-translational modifications

During unfolded protein response, a fragment of approximately 50 kDa containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 (MBTPS1, S1P) and site-2 (MBTPS2, S2P) proteases.. N-glycosylated. The glycosylation status may serve as a sensor for ER homeostasis, resulting in ATF6 activation to trigger the unfolded protein response (UPR).. Ubiquitinated by RNF186 at Lys-152, which is required for pattern recognition receptor-induced unfolded protein response-associated outcomes.

Product protocols

Target data

Cyclic AMP-dependent transcription factor ATF-6 alpha. Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 alpha), which is embedded in the endoplasmic reticulum membrane (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). Endoplasmic reticulum stress promotes processing of this form, releasing the transcription factor form that translocates into the nucleus, where it activates transcription of genes involved in the unfolded protein response (UPR) (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464).. Processed cyclic AMP-dependent transcription factor ATF-6 alpha. Transcription factor that initiates the unfolded protein response (UPR) during endoplasmic reticulum stress by activating transcription of genes involved in the UPR (PubMed : 10564271, PubMed : 11158310, PubMed : 11163209, PubMed : 11779464). Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3') (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor (PubMed : 10564271, PubMed : 11158310, PubMed : 11779464). May play a role in foveal development and cone function in the retina (PubMed : 26029869).
See full target information ATF6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com