JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB132520

Recombinant Human ATG16L1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATG16L1 protein is a Human Fragment protein, in the 85 to 607 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

APG16L, UNQ9393/PRO34307, ATG16L1, Autophagy-related protein 16-1, APG16-like 1

1 Images
SDS-PAGE - Recombinant Human ATG16L1 protein (AB132520)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATG16L1 protein (AB132520)

12.5% SDS-PAGE analysis of ab132520 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q676U5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB139484

Autophagy Assay Kit

4

2 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY","proteinLength":"Fragment","predictedMolecularWeight":"84.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":607,"aminoAcidStart":85,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q676U5","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATG16L1 also known as Autophagy Related 16 Like 1 is a protein involved in the autophagy process. It functions as part of a complex that includes ATG12 and ATG5. The molecular weight of ATG16L1 is approximately 66 kDa. It is highly expressed in various tissues including the immune cells highlighting its involvement in essential cellular processes. The protein interacts with other autophagy-related proteins to facilitate the elongation and maturation of autophagosomes.
Biological function summary

ATG16L1 plays a role in mediating autophagy a vital cellular degradation process. It forms a complex with ATG5 and ATG12 necessary for the elongation of the autophagosome membrane. Apart from its role in autophagy ATG16L1 contributes to the regulation of innate immunity by influencing the secretion of inflammatory cytokines. Its presence is essential for maintaining cellular homeostasis and proper immune responses.

Pathways

ATG16L1 is important in pathways like autophagy and immunity. In the autophagy pathway it works alongside ATG5 and ATG12 to ensure the proper formation of autophagosomes which are structures that engulf and degrade unwanted cellular components. Furthermore in the immune response pathway it helps regulate inflammation by managing cytokine production and secretion showing interaction with proteins like NOD2.

ATG16L1 has connections with inflammatory bowel diseases particularly Crohn's disease and various cancers. Mutations in ATG16L1 can lead to impaired autophagy contributing to the development of Crohn's disease. In cancer dysregulation of autophagy involving ATG16L1 may affect tumor progression and response to therapy. The protein associates with NOD2 in Crohn's disease demonstrating that changes in their interaction can influence disease susceptibility and severity.

Specifications

Form

Liquid

General info

Function

Plays an essential role in both canonical and non-canonical autophagy : interacts with ATG12-ATG5 to mediate the lipidation to ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAPL1, GABARAPL2 and GABARAP) (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576, PubMed : 29317426, PubMed : 30778222, PubMed : 33909989). Acts as a molecular hub, coordinating autophagy pathways via distinct domains that support either canonical or non-canonical signaling (PubMed : 29317426, PubMed : 30778222). During canonical autophagy, interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to ATG8 proteins, to produce a membrane-bound activated form of ATG8 (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576). Thereby, controls the elongation of the nascent autophagosomal membrane (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576). As part of the ATG8 conjugation system with ATG5 and ATG12, required for recruitment of LRRK2 to stressed lysosomes and induction of LRRK2 kinase activity in response to lysosomal stress (By similarity). Also involved in non-canonical autophagy, a parallel pathway involving conjugation of ATG8 proteins to single membranes at endolysosomal compartments, probably by catalyzing conjugation of phosphatidylserine (PS) to ATG8 (PubMed : 33909989). Non-canonical autophagy plays a key role in epithelial cells to limit lethal infection by influenza A (IAV) virus (By similarity). Regulates mitochondrial antiviral signaling (MAVS)-dependent type I interferon (IFN-I) production (PubMed : 22749352, PubMed : 25645662). Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response (PubMed : 24238340). Instead, promotes an autophagy-dependent antibacterial pathway together with NOD1 or NOD2 (PubMed : 20637199). Plays a role in regulating morphology and function of Paneth cell (PubMed : 18849966).

Sequence similarities

Belongs to the WD repeat ATG16 family.

Post-translational modifications

Proteolytic cleavage by activated CASP3 leads to degradation and may regulate autophagy upon cellular stress and apoptotic stimuli.. Phosphorylation at Ser-139 promotes association with the ATG12-ATG5 conjugate to form the ATG12-ATG5-ATG16L1 complex.

Product protocols

Target data

Plays an essential role in both canonical and non-canonical autophagy : interacts with ATG12-ATG5 to mediate the lipidation to ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAPL1, GABARAPL2 and GABARAP) (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576, PubMed : 29317426, PubMed : 30778222, PubMed : 33909989). Acts as a molecular hub, coordinating autophagy pathways via distinct domains that support either canonical or non-canonical signaling (PubMed : 29317426, PubMed : 30778222). During canonical autophagy, interacts with ATG12-ATG5 to mediate the conjugation of phosphatidylethanolamine (PE) to ATG8 proteins, to produce a membrane-bound activated form of ATG8 (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576). Thereby, controls the elongation of the nascent autophagosomal membrane (PubMed : 23376921, PubMed : 23392225, PubMed : 24553140, PubMed : 24954904, PubMed : 27273576). As part of the ATG8 conjugation system with ATG5 and ATG12, required for recruitment of LRRK2 to stressed lysosomes and induction of LRRK2 kinase activity in response to lysosomal stress (By similarity). Also involved in non-canonical autophagy, a parallel pathway involving conjugation of ATG8 proteins to single membranes at endolysosomal compartments, probably by catalyzing conjugation of phosphatidylserine (PS) to ATG8 (PubMed : 33909989). Non-canonical autophagy plays a key role in epithelial cells to limit lethal infection by influenza A (IAV) virus (By similarity). Regulates mitochondrial antiviral signaling (MAVS)-dependent type I interferon (IFN-I) production (PubMed : 22749352, PubMed : 25645662). Negatively regulates NOD1- and NOD2-driven inflammatory cytokine response (PubMed : 24238340). Instead, promotes an autophagy-dependent antibacterial pathway together with NOD1 or NOD2 (PubMed : 20637199). Plays a role in regulating morphology and function of Paneth cell (PubMed : 18849966).
See full target information ATG16L1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com