JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB222961

Recombinant human ATP1B1 protein (Active) (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human ATP1B1 protein (Active) (His tag C-Terminus) is a Human Fragment protein, in the 63 to 303 aa range, expressed in Baculovirus infected Sf21 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

ATP1B, ATP1B1, Sodium/potassium-transporting ATPase subunit beta-1, Sodium/potassium-dependent ATPase subunit beta-1

1 Images
SDS-PAGE - Recombinant human ATP1B1 protein (Active) (His tag C-Terminus) (AB222961)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human ATP1B1 protein (Active) (His tag C-Terminus) (AB222961)

SDS-PAGE - Recombinant human ATP1B1 protein (Active) (3 μg ab222961).

28-40 KDa under reducing conditions.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected Sf21 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Specific activity is > 3,000 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of Adenosine 5-triphosphate to phosphate per minute per minute at pH 7.5 at 25°C.

Accession

P05026

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Background reference: PMID 26506237.

Shi et al. Overexpression of ATP1B1 predicts an adverse prognosis in cytogenetically normal acute myeloid leukemia. Oncotarget. 2016 Jan 19;7(3):2585-95. doi: 10.18632/oncotarget.6226.

This product was previously labelled as beta 1 Sodium Potassium ATPase

Sequence info

[{"sequence":"ADPEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKSHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"29 kDa","actualMolecularWeight":null,"aminoAcidEnd":303,"aminoAcidStart":63,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf21 cells","accessionNumber":"P05026","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP1B1 also known as the beta-1 subunit of Na+/K+ ATPase plays an essential role in ion transport across the plasma membrane. The protein works as part of the sodium-potassium pump which helps maintain the cellular electrochemical gradient. The molecular mass of ATP1B1 is approximately 35 kDa. This target is expressed in various tissues including the heart kidney and brain where it supports the critical functions of excitable tissues and epithelial cell polarization.
Biological function summary

ATP1B1 contributes to establishing and maintaining cellular homeostasis as part of the Na+/K+ ATPase complex. This complex regulates the balance of sodium and potassium ions within cells important for nerve impulse transmission and muscle contraction. ATP1B1 interacts with the alpha subunit to modulate the enzyme’s activity and transport kinetics highlighting its role in cell volume regulation and epithelial layer development.

Pathways

ATP1B1 is actively involved in the ion transport pathway and cellular signaling pathways such as WNT signaling. It works closely with proteins such as ATP1A1 and ATP1A2 which are different alpha subunits of the Na+/K+ ATPase. Through these pathways ATP1B1 affects cellular processes like membrane potential maintenance and intercellular communication essential for proper cellular function and organismal health.

ATP1B1 shows a link to hypertension and polycystic ovary syndrome (PCOS). Mutations or dysfunctional expression of ATP1B1 can disrupt ion gradients contributing to these conditions. The protein connects with regulatory proteins including G-protein signaling regulators which can alter cellular responses in disease contexts. Understanding ATP1B1's involvement in these disorders helps in exploring therapeutic targets and improving patient outcomes.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane (PubMed : 19694409). Plays a role in innate immunity by enhancing virus-triggered induction of interferons (IFNs) and interferon stimulated genes (ISGs). Mechanistically, enhances the ubiquitination of TRAF3 and TRAF6 as well as the phosphorylation of TAK1 and TBK1 (PubMed : 34011520).. Involved in cell adhesion and establishing epithelial cell polarity.

Sequence similarities

Belongs to the X(+)/potassium ATPases subunit beta family.

Post-translational modifications

Glutathionylated (By similarity). N-glycosylated (By similarity).

Product protocols

Target data

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane (PubMed : 19694409). Plays a role in innate immunity by enhancing virus-triggered induction of interferons (IFNs) and interferon stimulated genes (ISGs). Mechanistically, enhances the ubiquitination of TRAF3 and TRAF6 as well as the phosphorylation of TAK1 and TBK1 (PubMed : 34011520).. Involved in cell adhesion and establishing epithelial cell polarity.
See full target information ATP1B1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com