JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB109956

Recombinant Human ATP5D protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP5D protein is a Human Full Length protein, in the 23 to 168 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

ATP5D, ATP5F1D, ATP synthase F1 subunit delta, F-ATPase delta subunit

1 Images
SDS-PAGE - Recombinant Human ATP5D protein (AB109956)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATP5D protein (AB109956)

15% SDS-PAGE analysis of 3 μg ab109956.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P30049

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.058% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE","proteinLength":"Full Length","predictedMolecularWeight":"17.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P30049","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP5D also known as ATP synthase subunit delta is a part of the mitochondrial ATP synthase complex. This protein plays a role in the conversion of ADP to ATP by facilitating proton flow across mitochondrial membranes. ATP5D has a molecular mass of approximately 18-20 kDa. Expression of ATP5D occurs in tissues with high energy demands such as the heart skeletal muscle and liver reflecting its role in energy metabolism.
Biological function summary

ATP5D contributes to the production of cellular energy by acting as an essential subunit in the F1 region of the F1Fo ATP synthase complex. This complex is responsible for ATP synthesis during oxidative phosphorylation. ATP5D's role is critical for maintaining the structural integrity and function of the ATP synthase complex. Its presence ensures efficient ATP production essential for various cellular processes.

Pathways

ATP5D functions within oxidative phosphorylation and energy metabolism pathways. It is closely associated with other ATP synthase subunits required for the ATP production process. Complex interactions include interactions with proteins such as ATP5A and ATP5B within the ATP synthase complex which work together in the energy production pathway essential for cell survival.

Defects or mutations in ATP5D can be related to mitochondrial diseases like mitochondrial encephalomyopathy. Alterations in its normal function can lead to improper cellular energy production. Additionally ATP5D mutations may impact disorders like Leigh syndrome where mitochondrial dysfunction plays a critical role. Understanding ATP5D's connections including those with proteins involved in these disorders helps unravel its impact on these conditions.

Specifications

Form

Liquid

Additional notes

ab109956 was purified using conventional chromatography.

General info

Function

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 29478781). F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits (PubMed : 1531933).

Sequence similarities

Belongs to the ATPase epsilon chain family.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 29478781). F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits (PubMed : 1531933).
See full target information ATP5F1D

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com