JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152211

Recombinant Human ATP5F1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP5F1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 256 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ATP5F1, ATP5PB, ATP synthase peripheral stalk-membrane subunit b, ATP synthase proton-transporting mitochondrial F(0) complex subunit B1, ATP synthase subunit b, ATPase subunit b

1 Images
SDS-PAGE - Recombinant Human ATP5F1 protein (GST tag N-Terminus) (AB152211)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATP5F1 protein (GST tag N-Terminus) (AB152211)

12.5% SDS-PAGE analysis of ab152211 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

P24539

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLETSLYKKAGTMLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM","proteinLength":"Full Length","predictedMolecularWeight":"55.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":256,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P24539","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP5F1 also known as ATP synthase F(0) complex subunit B1 is a protein found in the inner mitochondrial membrane. It is a component of the ATP synthase enzyme an important player in energy production with a molecular weight around 55 kDa. ATP5F1 is expressed abundantly in energy-demanding tissues such as the heart liver and skeletal muscle. This protein plays an important mechanical role in synthesizing adenosine triphosphate (ATP) by catalyzing the combination of adenosine diphosphate (ADP) and inorganic phosphate.
Biological function summary

ATP5F1 serves as an important part of the ATP synthase complex which consists of various subunits forming the F1 and Fo regions. This complex carries out the final step of oxidative phosphorylation in the mitochondria by using the proton gradient across the mitochondrial membrane to drive ATP production. As a critical process in cellular respiration ATP generation influences numerous cellular functions including muscle contraction nerve impulse propagation and synthesis of biomolecules.

Pathways

ATP5F1 operates within the oxidative phosphorylation and electron transport chain pathways. These pathways are important for maintaining the cell's energy balance. ATP5F1 works closely with other proteins such as ATP synthase Fo subunits aiding in proton translocation and ensuring efficient ATP synthesis. Disruptions in these pathways can have significant effects on cellular metabolism and energy homeostasis.

ATP5F1 is linked to mitochondrial dysfunctions such as mitochondrial myopathy and Leigh syndrome. These conditions result from impaired oxidative phosphorylation leading to insufficient ATP production. ATP5F1 interacts with the NADH dehydrogenase complex and mutations can affect their functionality contributing to these disorders. Understanding ATP5F1's role helps researchers explore therapeutic strategies aimed at managing these mitochondrial diseases.

Specifications

Form

Liquid

General info

Function

Subunit b, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256). Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).

Sequence similarities

Belongs to the eukaryotic ATPase B chain family.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Subunit b, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256). Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).
See full target information ATP5PB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com