JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB153084

Recombinant Human ATP5H protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP5H protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 161 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ATP5H, My032, ATP5PD, ATPase subunit d, ATP synthase peripheral stalk subunit d

1 Images
SDS-PAGE - Recombinant Human ATP5H protein (GST tag N-Terminus) (AB153084)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATP5H protein (GST tag N-Terminus) (AB153084)

ab153084 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O75947

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":161,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O75947","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP5H also known as ATP synthase subunit d is a component of the ATP synthase complex an important enzyme found in the mitochondria. It weighs approximately 18.4 kDa. This protein is part of the F1F0 ATP synthase complex specifically the F0 domain. ATP5H is highly expressed in tissues with high energy demand such as skeletal muscle and cardiac muscle indicating its important role in the cellular energy production.
Biological function summary

ATP5H facilitates the production of ATP the energy currency of the cell. It is essential in the synthesis of ATP from ADP and inorganic phosphate driven by a proton gradient across the mitochondrial membrane. ATP5H is integral to the structure of the F1F0 ATP synthase complex ensuring efficient proton translocation and ATP synthesis. This subunit is critical for the overall function and stability of the ATP synthase complex.

Pathways

ATP5H plays a role in oxidative phosphorylation and energy metabolism pathways. This protein interacts closely with other ATP synthase subunits including ATP5B and ATP5O orchestrating the conversion of energy derived from nutrients to ATP. The oxidative phosphorylation pathway is central to energy production in eukaryotic cells and ATP5H forms an essential link in this process.

ATP5H is implicated in mitochondrial dysfunctions and related conditions such as mitochondrial myopathies. Alterations or deficiencies in ATP5H can disrupt ATP production potentially leading to neuromuscular disorders. Additionally connections to ATP5A1 another subunit of ATP synthase are noted. Dysregulation in these interactions can provide insight into the molecular mechanisms of these diseases providing potential therapeutic targets.

Specifications

Form

Liquid

General info

Function

Subunit d, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256). Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).

Sequence similarities

Belongs to the ATPase d subunit family.

Product protocols

Target data

Subunit d, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256). Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements (By similarity).
See full target information ATP5PD

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com