JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314613

Recombinant Human ATP5J2 Protein (His Tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP5J2 Protein (His Tag) is a Human Full Length protein, in the 1 to 94 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

ATP5J2, ATP5JL, ATP5MF, ATP synthase membrane subunit f

1 Images
SDS-PAGE - Recombinant Human ATP5J2 Protein (His Tag) (AB314613)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ATP5J2 Protein (His Tag) (AB314613)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

10x His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P56134

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Storage buffer

pH: 7.4 - 8 Constituents: PBS, 6% Trehalose, 0.05% 2-Octadecoxyethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH","proteinLength":"Full Length","predictedMolecularWeight":"12.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":94,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P56134","tags":[{"tag":"10x His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Add glycerol to a final volume of 50% for extra stability and aliquot
Storage information
The product can be stored for up to 12 months
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

'ATP5J2' also known as ATP synthase-coupling factor 6 mitochondrial is a protein involved in the synthesis of ATP the primary energy carrier in cells. This protein integrates into the ATP synthase complex specifically the F0 part where it helps regulate proton flow. ATP5J2 is approximately 11 kDa in mass and appears predominantly in mitochondria the powerhouse of cells. It expresses widely in numerous tissues highlighting an important role in cellular energy metabolism fundamental to many physiological processes.
Biological function summary

ATP5J2 functions as an accessory subunit within the ATP synthase complex which is responsible for ATP production during oxidative phosphorylation. By participating in the regulation of proton translocation through the mitochondrial membrane ATP5J2 helps maintain the proton motive force necessary for ATP generation. The protein's involvement in metabolic energy conversion underlines its role in effective cellular respiration.

Pathways

ATP5J2 aligns with the oxidative phosphorylation pathway an essential metabolic route for energy production. It associates with other subunits of the ATP synthase complex such as ATP5B and ATP5O to fulfill regulatory roles in ATP synthesis. Additionally ATP5J2 has interactions within the mitochondrial electron transport chain contributing to the efficient function of this pathway and sustaining the energy requirements of cells.

Defects in ATP5J2 impact mitochondrial function linking it to mitochondrial diseases which often present with muscle weakness and neural disorders. Moreover abnormalities in ATP5J2 may associate with metabolic syndromes affecting global energy metabolism. These conditions highlight potential interactions with proteins like NDUFS1 another component of the electron transport chain where disturbances can exacerbate the impact of energy deficiencies on cellular health.

Specifications

Form

Lyophilized

General info

Function

Subunit f, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256).

Sequence similarities

Belongs to the ATPase F chain family.

Product protocols

Target data

Subunit f, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain (PubMed : 37244256). ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel (PubMed : 37244256). These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk (PubMed : 37244256). During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (Probable). In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro (By similarity). Part of the complex F(0) domain (PubMed : 37244256).
See full target information ATP5MF

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com