JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB104549

Recombinant Human ATP5O protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP5O protein (His tag N-Terminus) is a Human Full Length protein, in the 24 to 213 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

ATP5O, ATPO, ATP5PO, ATP synthase peripheral stalk subunit OSCP, Oligomycin sensitivity conferral protein, OSCP

1 Images
SDS-PAGE - Recombinant Human ATP5O protein (His tag N-Terminus) (AB104549)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ATP5O protein (His tag N-Terminus) (AB104549)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P48047

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV","proteinLength":"Full Length","predictedMolecularWeight":"23.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":213,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P48047","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP5O also known as OLIGOMYCIN SENSITIVITY CONFERRING PROTEIN (OSCP) plays an important role mechanically in the function of mitochondria. It is a component of the F1F0 ATP synthase complex responsible for the generation of ATP from ADP using the proton gradient across the mitochondrial membrane. ATP5O assists in the stabilization of the enzyme structure. The target protein has a molecular mass of approximately 23 kDa. Expression of ATP5O occurs in various tissues especially in muscles and organs with high energy demands such as the heart and liver.
Biological function summary

ATP5O assists in the energy production process by associating with the mitochondrial ATP synthase complex. It interacts closely with other subunits to form the stator stalk which is vital in the maintenance of the enzyme’s structural integrity during ATP synthesis. The proper function of ATP5O ensures effective conversion of the chemiosmotic energy into chemical energy within the mitochondria making metabolism efficient and supporting cellular energy requirements. This makes its role in energy homeostasis invaluable.

Pathways

ATP5O integrates into oxidative phosphorylation a pathway critical for cellular respiration and energy production. It collaborates with other ATP synthase subunits as well as cytochrome c to complete the electron transport chain culminating the release of ATP for cellular function. ATP5O’s activity impacts cellular energy homeostasis and interacts with proteins like ATP5A and ATP5B which are also part of the ATP synthase complex. Its involvement ensures effective energy transfer and metabolic adaptation to cellular demands.

ATP5O disruptions have links to mitochondrial disorders and neurodegenerative diseases. Mutations affecting ATP5O function can lead to compromised ATP production resulting in conditions like mitochondrial encephalomyopathy. Additionally dysfunctions in ATP5O may contribute to Alzheimer’s disease due to impaired energy metabolism. The link through disease pathways is often closely associated with proteins in the ATP synthase complex highlighting ATP5O's significance in maintaining mitochondrial and neuronal health.

Specifications

Form

Liquid

Additional notes

ab104549 is purified using conventional chromatography techniques.

General info

Function

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.

Sequence similarities

Belongs to the ATPase delta chain family.

Post-translational modifications

Acetylation at Lys-162 decreases ATP production. Deacetylated by SIRT3.. In response to mitochondrial stress, the precursor protein is ubiquitinated by the SIFI complex in the cytoplasm before mitochondrial import, leading to its degradation (PubMed:38297121). Within the SIFI complex, UBR4 initiates ubiquitin chain that are further elongated or branched by KCMF1 (PubMed:38297121).

Subcellular localisation

Mitochondrion

Product protocols

Target data

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.
See full target information ATP5PO

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com