JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160342

Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 351 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ATP6D, VPATPD, ATP6V0D1, V-type proton ATPase subunit d 1, V-ATPase subunit d 1, 32 kDa accessory protein, V-ATPase 40 kDa accessory protein, V-ATPase AC39 subunit, Vacuolar proton pump subunit d 1, p39

1 Images
SDS-PAGE - Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) (AB160342)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human ATP6V0D1/P39 protein (GST tag N-Terminus) (AB160342)

ab160342 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P61421

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as ATP6V0D1.

Sequence info

[{"sequence":"MSFFPEHYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":351,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P61421","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATP6V0D1 also known as P39 is a subunit of the V0 domain of the vacuolar ATPase (V-ATPase) complex. This protein has an approximate mass of 39 kDa. ATP6V0D1 is broadly expressed in various tissues with higher levels in metabolically active cells such as kidney and liver cells. The V-ATPase complex is essential for acidifying intracellular compartments which aids in numerous cellular processes including protein degradation and receptor-mediated endocytosis.
Biological function summary

ATP6V0D1 impacts the acidification necessary for intracellular processes by being a component of the V-ATPase complex. This complex functions as a proton pump moving protons across membranes to regulate pH in cellular compartments like lysosomes and endosomes. Proper function of V-ATPase and thereby of ATP6V0D1 is important for cellular homeostasis and energy metabolism. Disruption of these processes could impair critical functions such as protein degradation and nutrient processing.

Pathways

ATP6V0D1 plays roles in key cellular pathways such as the glucose metabolism pathway and protein processing in the endoplasmic reticulum. In these pathways ATP6V0D1 works closely with other proteins like ATP6V1 subunits within the V-ATPase complex. Its involvement in these pathways highlights not only its importance in cellular energy balance but also in maintaining the structural integrity of cells under varying metabolic conditions.

ATP6V0D1 is linked to conditions such as osteopetrosis and renal tubular acidosis. These disorders relate to the malfunction of acidification in cells where ATP6V0D1 expression is important highlighting the connection between disrupted ATP6V0D1 function and impaired cellular processes. Proteins like ATP6V0A1 another subunit of the V-ATPase complex also play a role in these conditions emphasizing the need for functional cooperation among these proteins to maintain normal physiological states.

Specifications

Form

Liquid

General info

Function

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed : 28296633, PubMed : 30374053, PubMed : 33065002). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (PubMed : 30374053). May play a role in coupling of proton transport and ATP hydrolysis (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed : 28296633). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity).

Sequence similarities

Belongs to the V-ATPase V0D/AC39 subunit family.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed : 28296633, PubMed : 30374053, PubMed : 33065002). V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment (PubMed : 30374053). May play a role in coupling of proton transport and ATP hydrolysis (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed : 28296633). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity).
See full target information ATP6V0D1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com