JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB130030

Recombinant Human ATPase Inhibitory Factor 1/IF1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human ATPase Inhibitory Factor 1/IF1 protein (His tag N-Terminus) is a Human Full Length protein, in the 26 to 106 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

ATPI, ATPIF1, ATP5IF1, ATP synthase F1 subunit epsilon, Inhibitor of F(1)F(o)-ATPase, IF(1), IF1

1 Images
SDS-PAGE - Recombinant Human ATPase Inhibitory Factor 1/IF1 protein (His tag N-Terminus) (AB130030)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human ATPase Inhibitory Factor 1/IF1 protein (His tag N-Terminus) (AB130030)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9UII2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as ATPase Inhibitory Factor 1.

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD","proteinLength":"Full Length","predictedMolecularWeight":"12.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":106,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UII2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ATPase Inhibitory Factor 1 (IF1) also referred to as IF1 protein ATPIF1 or ATPase inhibitory factor 1 is a small protein with a mass of approximately 12 kDa. It is expressed primarily in mitochondria-rich tissues such as the heart liver and brain where it plays an important role in energy metabolism. IF1 is notable for its ability to bind to the F1 subunit of the mitochondrial ATP synthase inhibiting its ATPase activity under specific conditions.
Biological function summary

IF1 influences mitochondrial function by regulating ATP synthase in response to changes in the cellular environment. Under conditions of low cellular energy IF1 stabilizes and prevents hydrolysis of ATP by binding to the F1 catalytic domain of the enzyme. This regulation helps to conserve ATP critical for maintaining cellular viability during stress. IF1 can also interact with other mitochondrial proteins to form complexes that influence energy homeostasis in the cell.

Pathways

IF1 integrates into pathways involved in cellular energy management including oxidative phosphorylation and ATP synthesis pathways. It interacts significantly with proteins such as the mitochondrial F1Fo-ATP synthase complex. By modulating ATP synthase activity IF1 ensures efficient ATP production and maintains mitochondrial membrane potential important for proper cell function.

IF1 has associations with metabolic conditions and cancer. Abnormal expression or activity of IF1 correlates with mitochondrial dysfunction often observed in cancer cells where it affects cell proliferation. Additionally IF1 has links to cardiac conditions given its role in regulating heart metabolism. It relates to proteins like the cytochrome c oxidase influencing cellular respiration and affecting disease progression.

Specifications

Form

Liquid

Additional notes

ab130030 was purified using conventional chromatography techniques.

General info

Function

Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F(1)F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues : regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme.

Sequence similarities

Belongs to the ATPase inhibitor family.

Post-translational modifications

Exhibits variability in chain length, mitochondria have distinct pools of protein cleaved after the 24th, 25th, and 26th amino acid.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Endogenous F(1)F(o)-ATPase inhibitor limiting ATP depletion when the mitochondrial membrane potential falls below a threshold and the F(1)F(o)-ATP synthase starts hydrolyzing ATP to pump protons out of the mitochondrial matrix. Required to avoid the consumption of cellular ATP when the F(1)F(o)-ATP synthase enzyme acts as an ATP hydrolase. Indirectly acts as a regulator of heme synthesis in erythroid tissues : regulates heme synthesis by modulating the mitochondrial pH and redox potential, allowing FECH to efficiently catalyze the incorporation of iron into protoporphyrin IX to produce heme.
See full target information ATP5IF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com