JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276372

Recombinant Human B4GALT1 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human B4GALT1 protein (His tag) is a Human Fragment protein, in the 44 to 398 aa range, expressed in HEK 293 cells, with >92%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

GGTB2, B4GALT1, Beta4Gal-T1, b4Gal-T1, Lactose synthase A protein, N-acetyllactosamine synthase, Nal synthase

1 Images
SDS-PAGE - Recombinant Human B4GALT1 protein (His tag) (AB276372)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human B4GALT1 protein (His tag) (AB276372)

SDS-PAGE analysis of ab276372

Key facts

Purity

>92% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15291

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS","proteinLength":"Fragment","predictedMolecularWeight":"41.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":398,"aminoAcidStart":44,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P15291","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

B4GALT1 also known as beta-14-galactosyltransferase 1 is an enzyme that facilitates the transfer of galactose residues from UDP-galactose to acceptor sugars forming β1-4 galactosidic linkages. This enzyme has an approximate mass of 60 kDa. It is primarily expressed in the Golgi apparatus of many cell types including epithelial cells and fibroblasts. B4GALT1 represents one of seven beta-14-galactosyltransferase enzymes each with varying specificity and function depending on the tissue type.
Biological function summary

B4GALT1 plays an important role in the modification of glycoproteins and glycolipids. It acts as part of a larger complex responsible for the formation and maintenance of glycan structures on cellular proteins which are important for cell-cell communication and protein stability. This modification process is essential for normal cellular functions because it impacts protein folding secretion and cell surface expression. B4GALT1 achieves this by participating in the synthesis of N-linked and O-linked glycans which directly influences various physiological processes.

Pathways

B4GALT1 functions in the glycosylation pathway where it modifies oligosaccharide chains during protein post-translational modification. This pathway is essential for the synthesis of glycoproteins which play a role in cell adhesion and signaling. B4GALT1 also contributes to the protein N-glycosylation metabolic pathway and interacts with proteins like ST3GAL1 which modify glycan structures further. These pathways are indispensable for proper cellular communication and function.

Defects or dysregulation of B4GALT1 can lead to conditions such as congenital disorders of glycosylation. Mutations in this enzyme have been linked to neurological and developmental abnormalities due to impaired glycan synthesis. B4GALT1 has also shown relevance in cancer influencing tumor progression and metastasis. It interacts with MUC1 a protein that when aberrantly glycosylated can promote cancer cell invasiveness and impede immune response therefore affecting cancer prognosis.

Specifications

Form

Lyophilized

General info

Function

Galactosyltransferase acting in the Golgi stacks. Catalyzes the transfer of galactose (Gal) from UDP-alpha-D-galactose in beta(1->4) linkage to the non-reducing terminal N-acetylglucosamine (GlcNAc) moieties of glycolipids and complex-type N-linked glycans (PubMed : 16157350, PubMed : 27872474, PubMed : 29133956, PubMed : 36280670, PubMed : 37632720, PubMed : 38321209). Adds one Gal residue to both GlcNAc beta(1->2)-linked to the alpha(1->3) and alpha(1->6) mannose antennae of complex-type N-glycans, enabling the formation of mono- and di-galactosylated glycoforms. Galactosylates complex-type N-glycans attached on the fragment crystallizable (Fc) of immunoglobulin-gamma isotypes (IgGs), a prerequisite for antibody glycan sialylation and related anti-inflammatory effector functions (PubMed : 27872474, PubMed : 29133956, PubMed : 36280670, PubMed : 37632720). Can also transfer a Gal residue to free GlcNAc to form N-acetyllactosamine (PubMed : 16157350). With LALBA/alpha-lactalbumin forms the lactose synthase complex responsible for production of large amounts of lactose in the lactating mammary gland. Interaction with LALBA alters the sugar substrate specificity of the catalytic domain, enabling high affinity binding of glucose and its transformation to lactose (PubMed : 16157350).. Isoform Long. The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, like those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix. Acts as a sperm receptor for ZP3 O-linked glycans on the zona pellucida leading to activation of G-protein signaling and acrosome reaction.. Processed beta-1,4-galactosyltransferase 1. The secreted form is proficient in galactosyltransferase activity and could be involved in glycan remodeling in biological fluids.

Sequence similarities

Belongs to the glycosyltransferase 7 family.

Post-translational modifications

The soluble form derives from the membrane forms by proteolytic processing.

Product protocols

Target data

Galactosyltransferase acting in the Golgi stacks. Catalyzes the transfer of galactose (Gal) from UDP-alpha-D-galactose in beta(1->4) linkage to the non-reducing terminal N-acetylglucosamine (GlcNAc) moieties of glycolipids and complex-type N-linked glycans (PubMed : 16157350, PubMed : 27872474, PubMed : 29133956, PubMed : 36280670, PubMed : 37632720, PubMed : 38321209). Adds one Gal residue to both GlcNAc beta(1->2)-linked to the alpha(1->3) and alpha(1->6) mannose antennae of complex-type N-glycans, enabling the formation of mono- and di-galactosylated glycoforms. Galactosylates complex-type N-glycans attached on the fragment crystallizable (Fc) of immunoglobulin-gamma isotypes (IgGs), a prerequisite for antibody glycan sialylation and related anti-inflammatory effector functions (PubMed : 27872474, PubMed : 29133956, PubMed : 36280670, PubMed : 37632720). Can also transfer a Gal residue to free GlcNAc to form N-acetyllactosamine (PubMed : 16157350). With LALBA/alpha-lactalbumin forms the lactose synthase complex responsible for production of large amounts of lactose in the lactating mammary gland. Interaction with LALBA alters the sugar substrate specificity of the catalytic domain, enabling high affinity binding of glucose and its transformation to lactose (PubMed : 16157350).. Isoform Long. The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, like those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix. Acts as a sperm receptor for ZP3 O-linked glycans on the zona pellucida leading to activation of G-protein signaling and acrosome reaction.. Processed beta-1,4-galactosyltransferase 1. The secreted form is proficient in galactosyltransferase activity and could be involved in glycan remodeling in biological fluids.
See full target information B4GALT1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com