JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177633

Recombinant Human Bestrophin/BEST1 protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Bestrophin/BEST1 protein (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 292 to 585 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

VMD2, BEST1, Bestrophin-1, TU15B, Vitelliform macular dystrophy protein 2

1 Images
SDS-PAGE - Recombinant Human Bestrophin/BEST1 protein (denatured) (His tag N-Terminus) (AB177633)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Bestrophin/BEST1 protein (denatured) (His tag N-Terminus) (AB177633)

SDS-PAGE analysis of ab177633

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O76090

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris-HCl buffer

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Bestrophin

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSEQLINPFGEDDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNKPEPQPPYTAASAQFRRASFMGSTFNISLNKEEMEFQPNQEDEEDAHAGIIGRFLGLQSHDHHPPRANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS","proteinLength":"Fragment","predictedMolecularWeight":"36 kDa","actualMolecularWeight":null,"aminoAcidEnd":585,"aminoAcidStart":292,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O76090","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Bestrophin also known as BEST1 or VMD2 is a protein that functions as a calcium-activated chloride channel. It plays an important role in the transport of ions across cell membranes. The molecular mass of BEST1 is about 68 kDa. This protein is prominently expressed in the retinal pigment epithelium (RPE) which is a layer of cells in the eye vital to the function and survival of the photoreceptors. These photoreceptors are responsible for capturing light and initiating vision.
Biological function summary

BEST1 influences the regulation of ionic homeostasis in the eye and contributes to the RPE's maintenance. It acts as part of a chloride channel complex that helps transport chloride ions which is important for fluid absorption and secretion in the retina. There are interactions with calcium ions that activate the channel allowing it to regulate the flow of other ions in response to changes in calcium concentration which is essential for maintaining the ionic balance necessary for proper vision.

Pathways

BEST1 plays significant roles in the visual cycle and ion transport pathways in the retina. It is related to the protein ANO2 another chloride channel although they interact differently with calcium ions. BEST1 influences the fluid regulation within the retina an essential part of the visual cycle pathway. It signals the movement of ions in response to external stimuli maintaining the balance of fluids and ions that reh cells function correctly.

Mutations in the BEST1 gene are connected to Best vitelliform macular dystrophy and adult-onset foveomacular dystrophy. Both disorders lead to retinal degeneration affecting vision. The interaction between BEST1 and other chloride channels like ANO2 suggests possible effects on the severity and progression of these retinal diseases highlighting the need for continued research into therapeutic interventions and the complex network of protein interactions within the retina.

Specifications

Form

Liquid

Additional notes

ab177633 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA

General info

Function

Ligand-gated anion channel that allows the movement of anions across cell membranes when activated by calcium (Ca2+) (PubMed : 11904445, PubMed : 12907679, PubMed : 18179881, PubMed : 18400985, PubMed : 19853238, PubMed : 21330666, PubMed : 26200502, PubMed : 26720466, PubMed : 35789156). Allows the movement of chloride and hydrogencarbonate (PubMed : 11904445, PubMed : 12907679, PubMed : 18179881, PubMed : 18400985, PubMed : 19853238, PubMed : 21330666, PubMed : 26200502, PubMed : 26720466, PubMed : 35789156). Found in a partially open conformation leading to significantly smaller chloride movement (PubMed : 35789156). Upon F2R/PAR-1 activation, the sequestered calcium is released into the cytosol of astrocytes, leading to the (Ca2+)-dependent release of L-glutamate into the synaptic cleft that targets the neuronal postsynaptic GRIN2A/NMDAR receptor resulting in the synaptic plasticity regulation (By similarity). Upon activation of the norepinephrine-alpha-1 adrenergic receptor signaling pathway, transports as well D-serine than L-glutamate in a (Ca2+)-dependent manner, leading to activation of adjacent NMDAR receptors and therefore regulates the heterosynaptic long-term depression and metaplasticity during initial memory acquisition (By similarity). Releases the 4-aminobutanoate neurotransmitter in a (Ca2+)-dependent manner, and participates in its tonic release from cerebellar glial cells (By similarity).

Sequence similarities

Belongs to the anion channel-forming bestrophin (TC 1.A.46) family. Calcium-sensitive chloride channel subfamily.

Product protocols

Target data

Ligand-gated anion channel that allows the movement of anions across cell membranes when activated by calcium (Ca2+) (PubMed : 11904445, PubMed : 12907679, PubMed : 18179881, PubMed : 18400985, PubMed : 19853238, PubMed : 21330666, PubMed : 26200502, PubMed : 26720466, PubMed : 35789156). Allows the movement of chloride and hydrogencarbonate (PubMed : 11904445, PubMed : 12907679, PubMed : 18179881, PubMed : 18400985, PubMed : 19853238, PubMed : 21330666, PubMed : 26200502, PubMed : 26720466, PubMed : 35789156). Found in a partially open conformation leading to significantly smaller chloride movement (PubMed : 35789156). Upon F2R/PAR-1 activation, the sequestered calcium is released into the cytosol of astrocytes, leading to the (Ca2+)-dependent release of L-glutamate into the synaptic cleft that targets the neuronal postsynaptic GRIN2A/NMDAR receptor resulting in the synaptic plasticity regulation (By similarity). Upon activation of the norepinephrine-alpha-1 adrenergic receptor signaling pathway, transports as well D-serine than L-glutamate in a (Ca2+)-dependent manner, leading to activation of adjacent NMDAR receptors and therefore regulates the heterosynaptic long-term depression and metaplasticity during initial memory acquisition (By similarity). Releases the 4-aminobutanoate neurotransmitter in a (Ca2+)-dependent manner, and participates in its tonic release from cerebellar glial cells (By similarity).
See full target information BEST1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com