JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271512

Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term) is a Human Full Length protein, in the 1 to 119 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE, Size Exclusion Chromatography.

View Alternative Names

FCRN, FCGRT, IgG receptor FcRn large subunit p51, FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor, CDABP0092, HDCMA22P, B2M, Beta-2-microglobulin

2 Images
Size Exclusion Chromatography - Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term) (AB271512)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term) (AB271512)

SEC analysis of ab271512.

SDS-PAGE - Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term) (AB271512)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human beta 2 Microglobulin+FCGRT/FCRN (Biotin) (10xHis+Avi C-Term) (AB271512)

SDS-PAGE analysis of ab271512.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

Size Exclusion Chromatography, SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

P55899

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 5 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Size Exclusion Chromatography": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Enzymatically biotin-labeled using Avi-tag™ technology.

Co-expressed in HEK-293 cells.

Sequence info

[{"sequence":"MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":119,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P61769","tags":[{"tag":"10x His","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]},{"sequence":"AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS","proteinLength":"Fragment","predictedMolecularWeight":"34 kDa","actualMolecularWeight":null,"aminoAcidEnd":297,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P61769","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|Store in the dark
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Beta-2 microglobulin (B2M) is a component of the major histocompatibility complex (MHC) class I molecules which are integral to the immune system. It is also associated with the neonatal Fc receptor (FCGRT or FcRn). The B2M protein has a mass of approximately 11.8 kDa. This protein is widely expressed with notable expression in all nucleated cells. In humans the role of B2M includes antigen presentation to T cells and it aids in the stabilization of MHC molecules.
Biological function summary

B2M interacts with the neonatal Fc receptor and is involved in the regulation of IgG antibody levels by extending their half-life. As part of the FcRn complex B2M also aids in the transport of IgG across epithelial barriers such as the intestinal lining in neonatal mammals. This complex plays a significant role in maintaining the homeostasis of IgG antibodies therefore impacting adaptive immunity.

Pathways

B2M participates in antigen processing and presentation. It forms a complex with FCGRT which is critical in the FcRn pathway responsible for the recycling and transcytosis of immunoglobulins. This interaction preserves IgG from lysosomal degradation. Additionally B2M interacts with other proteins like albumin through related pathways highlighting its involvement in protein recycling and homeostasis.

B2M is relevant to several autoimmune diseases such as rheumatoid arthritis and systemic lupus erythematosus. Altered B2M levels are indicative of these conditions reflecting immune dysregulation. Higher levels of B2M are also observed in multiple myeloma a disorder featuring malignancies of plasma cells. In these disease contexts B2M often serves as a biomarker alongside elevated levels of IgG or the presence of paraproteins.

Specifications

Form

Liquid

General info

Function

Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk (PubMed : 10933786, PubMed : 7964511). IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation (PubMed : 10998088). In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB (PubMed : 24469444, PubMed : 28330995).. (Microbial infection) Acts as an uncoating receptor for a panel of echoviruses including Echovirus 5, 6, 7, 9, 11, 13, 25 and 29.

Sequence similarities

Belongs to the immunoglobulin superfamily.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk (PubMed : 10933786, PubMed : 7964511). IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation (PubMed : 10998088). In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB (PubMed : 24469444, PubMed : 28330995).. (Microbial infection) Acts as an uncoating receptor for a panel of echoviruses including Echovirus 5, 6, 7, 9, 11, 13, 25 and 29.
See full target information FCGRT

Additional targets

B2M

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com