JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB236168

Recombinant Human beta IV Tubulin protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human beta IV Tubulin protein (His tag) is a Human Full Length protein, in the 1 to 444 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

TUBB4, TUBB5, TUBB4A, Tubulin beta-4A chain, Tubulin 5 beta, Tubulin beta-4 chain

1 Images
SDS-PAGE - Recombinant Human beta IV Tubulin protein (His tag) (AB236168)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human beta IV Tubulin protein (His tag) (AB236168)

Analysis of ab236168 (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P04350

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA","proteinLength":"Full Length","predictedMolecularWeight":"53.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":444,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P04350","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Beta IV Tubulin also known as TUBB4 is an important component of the microtubule structure within cells. It has a molecular mass of approximately 50 kDa. This protein is a critical part of the cytoskeleton and is expressed in a variety of tissues including neuronal tissues. Beta IV Tubulin plays a role in forming dynamic structures that aid in maintaining cell shape facilitating intracellular transport and enabling cell division. Researchers often use beta tubulin staining techniques to observe microtubules in cells which is important for understanding cellular processes.
Biological function summary

Beta IV Tubulin contributes significantly to the stability and function of microtubule networks. It is a member of the tubulin family and often forms tubulin heterodimers which are building blocks of microtubules. These microtubules are essential for many cellular activities such as mitosis and transport of organelles. Beta IV Tubulin is integral to the microtubule-based cellular processes and its functions are critical for neuronal development and function because it is a part of the complex cytoskeletal framework.

Pathways

Beta IV Tubulin is deeply involved in cellular processes such as the MAP kinase pathway and cell cycle regulation. These pathways are pivotal in transmitting signals that regulate cellular processes including growth and differentiation. The protein interacts with other tubulin isotypes and motor proteins like dynein and kinesin contributing to intracellular transport and chromosomal segregation during cell division. These interactions highlight its importance in maintaining proper cellular responses and functions.

Mutations or dysregulation of beta IV Tubulin are associated with neurological conditions like dystonia and Charcot-Marie-Tooth disease. These disorders underline the importance of beta IV Tubulin in neuronal health and development. The protein’s interaction with other tubulins and motor proteins also relates it to neurodegenerative diseases where cytoskeletal integrity and function are often compromised. Understanding these interactions helps unravel the pathogenic mechanisms of these diseases and can guide therapeutic strategies.

Specifications

Form

Liquid

General info

Function

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin.

Sequence similarities

Belongs to the tubulin family.

Post-translational modifications

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group (PubMed:26875866). Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed:26875866). Glutamylation is also involved in cilia motility (By similarity).. Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into cilia and flagella axonemes, which is required for their stability and maintenance. Flagella glycylation controls sperm motility. Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally.. Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin.
See full target information TUBB4A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com