JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112387

Recombinant Human Bim protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Bim protein is a Human Full Length Bim protein, in the 1 to 112 aa range, expressed in Wheat germ and suitable for western blot, SDS-PAGE and ELISA. The predicted molecular weight of ab91136 protein is 38.8 kDa.

- Save time and ensure accurate results - use our BIM protein as a control

View Alternative Names

BIM, BCL2L11, Bcl-2-like protein 11, Bcl2-L-11, Bcl2-interacting mediator of cell death

1 Images
SDS-PAGE - Recombinant Human Bim protein (GST tag N-Terminus) (AB112387)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Bim protein (GST tag N-Terminus) (AB112387)

12.5% SDS-PAGE analysis of ab112387. Stained with Coomassie Blue

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

O43521

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(recombinant protein)</p>" } } }

Product details

Ensure the validity of your result using our recombinant human Bim protein ab112387 as a positive control in western blot and SDS-PAGE.

Analyze your Bim/ Bcl-2-like protein 11 (BCL2L11) ELISA data using the ab112387 protein to generate and plot a standard curve.

Check out of western blot protocol for more information here

Check out our protein gel staining guide for SDS-PAGE here

Check out our ELISA protocol for more information here.

Sequence info

[{"sequence":"MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS","proteinLength":"Full Length","predictedMolecularWeight":"38.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":112,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O43521","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Bim also known as Bcl-2-interacting mediator of cell death is an important pro-apoptotic protein within the Bcl-2 family. It has a molecular weight of approximately 23 kDa. Bim is expressed in various tissues including the immune system nervous system and lymphoid tissues. It exists in multiple isoforms such as BimEL BimL and BimS due to alternative splicing. Bim's interaction with cellular membranes allows it to regulate apoptotic processes through mitochondrial pathways effectively.
Biological function summary

Bim regulates apoptosis by binding to pro-survival proteins like Bcl-2 and Bcl-xL releasing pro-apoptotic factors from mitochondria and activating caspases. Bim acts as part of the apoptosome complex and influences cell death regulation significantly. By promoting cytochrome c release from mitochondria Bim initiates a cascade of events leading to cell apoptosis. This regulation is vital in maintaining the balance between cell survival and death necessary for normal development and tissue homeostasis.

Pathways

Bim plays a critical role in the intrinsic apoptotic pathway. This pathway involves mitochondrial outer membrane permeabilization where Bim interacts with several Bcl-2 family proteins such as Bax and Bak to induce apoptosis. The modulation of Bim expression and activity is influenced by growth factor signaling pathways such as the PI3K-Akt pathway which affects Bim phosphorylation leading to its inactivation and subsequent degradation. Therefore Bim acts as an important node linking survival signals and apoptotic machinery.

Bim dysregulation has been implicated in conditions like cancer and autoimmune diseases. In certain cancers reduced Bim expression can result in unchecked cell proliferation and resistance to apoptosis. Conversely in autoimmune disorders overactivity of Bim may lead to excessive immune cell apoptosis contributing to disease pathogenesis. Bim's interactions with proteins like Bcl-2 and Bcl-xL are significant in cancer therapy as targeting these interactions can help overcome resistance to apoptosis in cancer cells improving treatment outcomes.

Specifications

Form

Liquid

General info

Function

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.

Sequence similarities

Belongs to the Bcl-2 family.

Post-translational modifications

Phosphorylation at Ser-69 by MAPK1/MAPK3 leads to interaction with TRIM2 and polyubiquitination, followed by proteasomal degradation (PubMed:15486195, PubMed:21478148). Deubiquitination catalyzed by USP27X stabilizes the protein (By similarity).. Ubiquitination by TRIM2 following phosphorylation by MAPK1/MAPK3 leads to proteasomal degradation. Conversely, deubiquitination catalyzed by USP27X stabilizes the protein.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.
See full target information BCL2L11

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

The Canadian journal of cardiology 35:875-883 PubMed31292086

2019

Role of the mTOR Signalling Pathway in Human Sepsis-Induced Myocardial Dysfunction.

Applications

Unspecified application

Species

Unspecified reactive species

Wei Cheng Mm,Yun Long,Hao Wang,Wen Han Mm,Jiahui Zhang,Na Cui
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com