JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB151881

Recombinant Human BNP protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human BNP protein is a Human Full Length protein, in the 27 to 134 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

Natriuretic peptides B, Brain natriuretic factor prohormone, Gamma-brain natriuretic peptide, Iso-ANP, preproBNP, proBNP, NPPB

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

P16860

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 79% Phosphate Buffer, 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.03% EDTA, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH","proteinLength":"Full Length","predictedMolecularWeight":"11.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":134,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P16860","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab151881 is supplied as a 0.2 µm filtered solution.

General info

Function

Brain natriuretic peptide 32. Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed : 1672777, PubMed : 17372040, PubMed : 1914098, PubMed : 9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed : 1672777, PubMed : 17349887, PubMed : 17372040, PubMed : 21098034, PubMed : 25339504, PubMed : 9458824). Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed : 1914098, PubMed : 9458824). Binds the clearance receptor NPR3 (PubMed : 16870210).. NT-proBNP. May affect cardio-renal homeostasis (PubMed : 17372040). Able to promote the production of cGMP although its potency is very low compared to brain natriuretic peptide 32 (PubMed : 17372040).. BNP(3-32). May have a role in cardio-renal homeostasis (PubMed : 17372040). Able to promote the production of cGMP (PubMed : 17372040).

Sequence similarities

Belongs to the natriuretic peptide family.

Post-translational modifications

The precursor molecule is proteolytically cleaved by the endoproteases FURIN or CORIN at Arg-102 to produce brain natriuretic peptide 32 and NT-proBNP (PubMed:10880574, PubMed:20489134, PubMed:21314817, PubMed:21482747, PubMed:21763278). This likely occurs after it has been secreted into the blood, either during circulation or in the target cells (PubMed:21482747). CORIN also cleaves the precursor molecule at additional residues including Arg-99 and possibly Lys-105 (PubMed:20489134, PubMed:21763278). In patients with heart failure, processing and degradation of natriuretic peptides B occurs but is delayed, possibly due to a decrease in enzyme level or activity of CORIN and DPP4 (PubMed:25339504).. Brain natriuretic peptide 32. Undergoes further proteolytic cleavage by various proteases such as DPP4, MME and possibly FAP, to give rise to a variety of shorter peptides (PubMed:16254193, PubMed:19808300, PubMed:21098034, PubMed:21314817). Cleaved at Pro-104 by the prolyl endopeptidase FAP (seprase) activity (in vitro) (PubMed:21314817). Degraded by IDE (PubMed:21098034). During IDE degradation, the resulting products initially increase the activation of NPR1 and can also stimulate NPR2 to produce cGMP before the fragments are completely degraded and inactivated by IDE (in vitro) (PubMed:21098034).. O-glycosylated on at least seven residues (PubMed:16750161, PubMed:17349887, PubMed:20489134, PubMed:21482747, PubMed:21763278). In cardiomyocytes, glycosylation at Thr-97 is essential for the stability and processing of the extracellular natriuretic peptides B (PubMed:21482747). Glycosylation, especially at Thr-97, may also be important for brain natriuretic peptide 32 stability and/or extracellular distribution (PubMed:21763278). Glycosylation at Thr-97 appears to inhibit FURIN- or CORIN-mediated proteolytic processing, at least in HEK293 cells (PubMed:20489134, PubMed:21763278).

Product protocols

Target data

Brain natriuretic peptide 32. Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed : 1672777, PubMed : 17372040, PubMed : 1914098, PubMed : 9458824). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed : 1672777, PubMed : 17349887, PubMed : 17372040, PubMed : 21098034, PubMed : 25339504, PubMed : 9458824). Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed : 1914098, PubMed : 9458824). Binds the clearance receptor NPR3 (PubMed : 16870210).. NT-proBNP. May affect cardio-renal homeostasis (PubMed : 17372040). Able to promote the production of cGMP although its potency is very low compared to brain natriuretic peptide 32 (PubMed : 17372040).. BNP(3-32). May have a role in cardio-renal homeostasis (PubMed : 17372040). Able to promote the production of cGMP (PubMed : 17372040).
See full target information NPPB

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Lab on a chip 19:1676-1685 PubMed30942226

2019

Simultaneous detection of multiple NT-proBNP clinical samples utilizing an aptamer-based sandwich assay on an integrated microfluidic system.

Applications

Unspecified application

Species

Unspecified reactive species

Anirban Sinha,Priya Gopinathan,Yi-Da Chung,Shu-Chu Shiesh,Gwo-Bin Lee

Circulation. Cardiovascular genetics 9:375-83 PubMed27329291

2016

Associations Between Common and Rare Exonic Genetic Variants and Serum Levels of 20 Cardiovascular-Related Proteins: The Tromsø Study.

Applications

Unspecified application

Species

Unspecified reactive species

Terry Solomon,Erin N Smith,Hiroko Matsui,Sigrid K Braekkan,Tom Wilsgaard,Inger Njølstad,Ellisiv B Mathiesen,John-Bjarne Hansen,Kelly A Frazer
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com