JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316065

Recombinant Human BPIFA1/LUNX protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human BPIFA1/LUNX protein is a Human Fragment protein, in the 20 to 256 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level.

View Alternative Names

LUNX, NASG, PLUNC, SPLUNC1, SPURT, UNQ787/PRO1606, BPIFA1, BPI fold-containing family A member 1, Lung-specific protein X, Nasopharyngeal carcinoma-related protein, Palate lung and nasal epithelium clone protein, Secretory protein in upper respiratory tracts, Short PLUNC1, Tracheal epithelium-enriched protein, Von Ebner protein Hl

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

Tag free

Biologically active

No

Accession

Q9NP55

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

Constituents: PBS

storage-buffer

Sequence info

[{"sequence":"QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV","proteinLength":"Fragment","predictedMolecularWeight":"24.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":256,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9NP55","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The Palate Lung Nasal Epithelium Clone (PLUNC) also known as SPLUNC1 or BPI-fold containing family A member 1 is a protein involved in host defense mechanisms. It has a molecular mass of approximately 25 kDa. High expression levels are found in the upper respiratory tract where it plays a role in airway surface liquid homeostasis. You can also detect it in salivary glands and other mucosal surfaces. Its expression is linked to innate immunity providing a first line of defense.
Biological function summary

This protein functions to modulate the physical and chemical environment at mucosal surfaces. It helps maintain the integrity of epithelial barriers against pathogens. As part of no particular protein complex PLUNC acts as a surfactant with anti-microbial properties in respiratory tissues. It helps maintain the viscosity and hydration of airway secretions facilitating the trapping and clearance of inhaled pathogens and particles.

Pathways

PLUNC is implicated in innate immune responses and mucosal defense mechanisms. It interacts within pathways involving the regulation of inflammation and mucociliary clearance. Proteins related to PLUNC in these pathways include SBEM and the airway-specific secretory proteins. Through these interactions it helps the lungs manage both pathogen load and airway clearances such as mucociliary escalator actions necessary to protect the respiratory system.

PLUNC is related to cystic fibrosis and chronic rhinosinusitis. In cystic fibrosis its regulation affects mucus viscosity and bacterial colonization potentially worsening respiratory symptoms. In chronic rhinosinusitis altered expression of PLUNC links to inflammation and recurrent infections. It connects with CFTR protein in cystic fibrosis impacting ion transport and mucociliary function. Through these mechanisms PLUNC can play a significant role in the progression of specific airway-related conditions.

Specifications

Form

Liquid

General info

Function

Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC) (PubMed : 25223608). Plays a role in the innate immune responses of the upper airways (PubMed : 23132494, PubMed : 23499554). Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae (PubMed : 23132494, PubMed : 23499554, PubMed : 27145151). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus (PubMed : 24043776, PubMed : 24124190). Plays a role in the airway inflammatory response after exposure to irritants (PubMed : 11425234). May attract macrophages and neutrophils (PubMed : 23132494).

Sequence similarities

Belongs to the BPI/LBP/Plunc superfamily. Plunc family.

Post-translational modifications

May be N-glycosylated.

Product protocols

Target data

Lipid-binding protein which shows high specificity for the surfactant phospholipid dipalmitoylphosphatidylcholine (DPPC) (PubMed : 25223608). Plays a role in the innate immune responses of the upper airways (PubMed : 23132494, PubMed : 23499554). Reduces the surface tension in secretions from airway epithelia and inhibits the formation of biofilm by pathogenic Gram-negative bacteria, such as P.aeruginosa and K.pneumoniae (PubMed : 23132494, PubMed : 23499554, PubMed : 27145151). Negatively regulates proteolytic cleavage of SCNN1G, an event that is required for activation of the epithelial sodium channel (ENaC), and thereby contributes to airway surface liquid homeostasis and proper clearance of mucus (PubMed : 24043776, PubMed : 24124190). Plays a role in the airway inflammatory response after exposure to irritants (PubMed : 11425234). May attract macrophages and neutrophils (PubMed : 23132494).
See full target information BPIFA1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com