JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276534

Recombinant Human BST2/Tetherin protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human BST2/Tetherin protein (His tag) is a Human Fragment protein, in the 49 to 160 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD317, Bone marrow stromal antigen 2, BST-2, HM1.24 antigen, Tetherin, BST2

1 Images
SDS-PAGE - Recombinant Human BST2/Tetherin protein (His tag) (AB276534)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human BST2/Tetherin protein (His tag) (AB276534)

SDS-PAGE analysis of ab276534

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q10589

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS","proteinLength":"Fragment","predictedMolecularWeight":"14.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":160,"aminoAcidStart":49,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q10589","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Lyophilized

General info

Function

IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted (PubMed : 18200009, PubMed : 18342597, PubMed : 19036818, PubMed : 19879838, PubMed : 20019814, PubMed : 20399176, PubMed : 20419159, PubMed : 20940320, PubMed : 21529378, PubMed : 22520941). Its target viruses belong to diverse families, including retroviridae : human immunodeficiency virus type 1 (HIV-1), human immunodeficiency virus type 2 (HIV-2), simian immunodeficiency viruses (SIVs), equine infectious anemia virus (EIAV), feline immunodeficiency virus (FIV), prototype foamy virus (PFV), Mason-Pfizer monkey virus (MPMV), human T-cell leukemia virus type 1 (HTLV-1), Rous sarcoma virus (RSV) and murine leukemia virus (MLV), flavivirideae : hepatitis C virus (HCV), filoviridae : ebola virus (EBOV) and marburg virus (MARV), arenaviridae : lassa virus (LASV) and machupo virus (MACV), herpesviridae : kaposis sarcoma-associated herpesvirus (KSHV), rhabdoviridae : vesicular stomatitis virus (VSV), orthomyxoviridae : influenza A virus, paramyxoviridae : nipah virus, and coronaviridae : SARS-CoV (PubMed : 18200009, PubMed : 18342597, PubMed : 19179289, PubMed : 19879838, PubMed : 20399176, PubMed : 20419159, PubMed : 20686043, PubMed : 20943977, PubMed : 21529378, PubMed : 21621240, PubMed : 22520941, PubMed : 26378163, PubMed : 31199522). Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration (PubMed : 22065321). Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection (PubMed : 19564354, PubMed : 26172439). Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. Isoform 1 and isoform 2 are both effective viral restriction factors but have differing antiviral and signaling activities (PubMed : 23028328, PubMed : 26172439). Isoform 2 is resistant to HIV-1 Vpu-mediated degradation and restricts HIV-1 viral budding in the presence of Vpu (PubMed : 23028328, PubMed : 26172439). Isoform 1 acts as an activator of NF-kappa-B and this activity is inhibited by isoform 2 (PubMed : 23028328).

Sequence similarities

Belongs to the tetherin family.

Post-translational modifications

Monoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation.. The GPI anchor is essential for its antiviral activity.

Subcellular localisation

Late endosome

Product protocols

Target data

IFN-induced antiviral host restriction factor which efficiently blocks the release of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Acts as a direct physical tether, holding virions to the cell membrane and linking virions to each other. The tethered virions can be internalized by endocytosis and subsequently degraded or they can remain on the cell surface. In either case, their spread as cell-free virions is restricted (PubMed : 18200009, PubMed : 18342597, PubMed : 19036818, PubMed : 19879838, PubMed : 20019814, PubMed : 20399176, PubMed : 20419159, PubMed : 20940320, PubMed : 21529378, PubMed : 22520941). Its target viruses belong to diverse families, including retroviridae : human immunodeficiency virus type 1 (HIV-1), human immunodeficiency virus type 2 (HIV-2), simian immunodeficiency viruses (SIVs), equine infectious anemia virus (EIAV), feline immunodeficiency virus (FIV), prototype foamy virus (PFV), Mason-Pfizer monkey virus (MPMV), human T-cell leukemia virus type 1 (HTLV-1), Rous sarcoma virus (RSV) and murine leukemia virus (MLV), flavivirideae : hepatitis C virus (HCV), filoviridae : ebola virus (EBOV) and marburg virus (MARV), arenaviridae : lassa virus (LASV) and machupo virus (MACV), herpesviridae : kaposis sarcoma-associated herpesvirus (KSHV), rhabdoviridae : vesicular stomatitis virus (VSV), orthomyxoviridae : influenza A virus, paramyxoviridae : nipah virus, and coronaviridae : SARS-CoV (PubMed : 18200009, PubMed : 18342597, PubMed : 19179289, PubMed : 19879838, PubMed : 20399176, PubMed : 20419159, PubMed : 20686043, PubMed : 20943977, PubMed : 21529378, PubMed : 21621240, PubMed : 22520941, PubMed : 26378163, PubMed : 31199522). Can inhibit cell surface proteolytic activity of MMP14 causing decreased activation of MMP15 which results in inhibition of cell growth and migration (PubMed : 22065321). Can stimulate signaling by LILRA4/ILT7 and consequently provide negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection (PubMed : 19564354, PubMed : 26172439). Plays a role in the organization of the subapical actin cytoskeleton in polarized epithelial cells. Isoform 1 and isoform 2 are both effective viral restriction factors but have differing antiviral and signaling activities (PubMed : 23028328, PubMed : 26172439). Isoform 2 is resistant to HIV-1 Vpu-mediated degradation and restricts HIV-1 viral budding in the presence of Vpu (PubMed : 23028328, PubMed : 26172439). Isoform 1 acts as an activator of NF-kappa-B and this activity is inhibited by isoform 2 (PubMed : 23028328).
See full target information BST2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com