JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB43600

Recombinant Human c-Jun protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human c-Jun protein is a Human Fragment protein, in the 1 to 79 aa range, expressed in Escherichia coli, with 50%, suitable for SDS-PAGE.

View Alternative Names

Transcription factor Jun, Activator protein 1, Proto-oncogene c-Jun, Transcription factor AP-1 subunit Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39, AP1, JUN

Key facts

Purity

50% Densitometry

Purity was determined to be appromimately 50% by densitometry

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P05412

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.00385% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.00174% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":79,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P05412","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein c-Jun is an important component of the AP-1 transcription factor complex and is often referred to by alternative names such as c-jun. It has a molecular weight of about 39 kDa. Scientists have found c-jun expressed in a wide range of tissues indicating its diverse roles in cellular functions. This protein plays a critical mechanical role by binding specific DNA sequences to regulate the transcription of various genes involved in cell proliferation and apoptosis.
Biological function summary

C-Jun impacts cellular activities by being a significant part of the AP-1 transcription factor complex interacting with other proteins such as Fos. This interaction allows c-Jun to modulate gene expression in response to cellular stimuli. In particular c-Jun influences cell cycle progression and differentiation. Therefore its activity is necessary for physiological and pathological processes. As c-jun's function remains tightly regulated any changes can have wide-ranging effects.

Pathways

C-Jun significantly influences the MAPK/ERK and JNK pathways. These pathways play important roles in cellular responses to stress growth factors and cytokines. Within these pathways c-Jun interacts with proteins such as JNK which phosphorylates c-Jun and enhances its activity. These interactions allow c-Jun to regulate target genes involved in important cellular processes without much delay. Understanding c-Jun's function in these pathways helps elucidate how cells control division survival and apoptosis.

C-Jun's dysregulation connects to various conditions including cancer and neurodegenerative diseases. Abnormal c-Jun activity can lead to oncogenesis by promoting unrestrained cellular proliferation. Additionally c-Jun involvement in disorders like Alzheimer's disease stems from its role in apoptotic pathways which may cause neuronal death. Accompanying proteins like JNK are also implicated in these conditions making the regulation and expression of c-Jun a focus for therapeutic research.

General info

Function

Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed : 10995748, PubMed : 22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to the AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing its transcriptional activity (By similarity). Together with FOSB, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed : 12618758). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed : 17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed : 24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed : 24623306).. (Microbial infection) Upon Epstein-Barr virus (EBV) infection, binds to viral BZLF1 Z promoter and activates viral BZLF1 expression.

Sequence similarities

Belongs to the bZIP family. Jun subfamily.

Post-translational modifications

Ubiquitinated by the SCF(FBXW7), leading to its degradation (PubMed:14739463, PubMed:27458189). Ubiquitination takes place following phosphorylation, that promotes interaction with FBXW7 (PubMed:14739463).. Phosphorylated by CaMK4 and PRKDC; phosphorylation enhances the transcriptional activity. Phosphorylated by HIPK3. Phosphorylated by DYRK2 at Ser-243; this primes the protein for subsequent phosphorylation by GSK3B at Thr-239. Phosphorylated at Thr-239, Ser-243 and Ser-249 by GSK3B; phosphorylation reduces its ability to bind DNA. Phosphorylated by PAK2 at Thr-2, Thr-8, Thr-89, Thr-93 and Thr-286 thereby promoting JUN-mediated cell proliferation and transformation. Phosphorylated by PLK3 following hypoxia or UV irradiation, leading to increase DNA-binding activity. Phosphorylated by VRK1 (PubMed:31527692).. Acetylated at Lys-271 by EP300.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription factor that recognizes and binds to the AP-1 consensus motif 5'-TGA[GC]TCA-3' (PubMed : 10995748, PubMed : 22083952). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to the AP-1 consensus sequence 5'-TGA[GC]TCA-3' and enhancing its transcriptional activity (By similarity). Together with FOSB, plays a role in activation-induced cell death of T cells by binding to the AP-1 promoter site of FASLG/CD95L, and inducing its transcription in response to activation of the TCR/CD3 signaling pathway (PubMed : 12618758). Promotes activity of NR5A1 when phosphorylated by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation (PubMed : 17210646). Involved in activated KRAS-mediated transcriptional activation of USP28 in colorectal cancer (CRC) cells (PubMed : 24623306). Binds to the USP28 promoter in colorectal cancer (CRC) cells (PubMed : 24623306).. (Microbial infection) Upon Epstein-Barr virus (EBV) infection, binds to viral BZLF1 Z promoter and activates viral BZLF1 expression.
See full target information JUN

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com