JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114469

Recombinant Human c-Maf protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human c-Maf protein is a Human Fragment protein, in the 304 to 403 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Transcription factor Maf, Proto-oncogene c-Maf, V-maf musculoaponeurotic fibrosarcoma oncogene homolog, MAF

1 Images
SDS-PAGE - Recombinant Human c-Maf protein (AB114469)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human c-Maf protein (AB114469)

ab114469 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

O75444

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":403,"aminoAcidStart":304,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O75444","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The c-Maf protein also known as Maf or MAF is a member of the large MAF family of basic leucine zipper (bZIP) transcription factors. This protein plays a significant role in the regulation of gene expression. It has a molecular weight of approximately 38 kDa. c-Maf is commonly expressed in various tissues such as the lens of the eye the kidneys and specific immune cells including T cells and macrophages. It is widely studied due to its involvement in transcriptional activation of certain target genes.
Biological function summary

C-Maf protein influences cellular differentiation and function particularly in immune cells. It forms part of a transcriptional complex that regulates genes critical for the production of interleukins and other cytokines. In the immune system c-Maf is essential for the differentiation of T-helper 2 cells and influences the production of cytokines such as IL-4. Additionally it is involved in the maturation of lens fibers in the eye and modulation of renal functions.

Pathways

C-Maf plays an important role in the immune and visual system. It is part of the signaling pathways that regulate Th2 cytokine genes including IL-4 within the adaptive immune response. This process involves interaction with other transcription factors such as STAT6 and GATA3. Moreover the lens development pathway also includes c-Maf where it works with proteins like CRYAA to maintain lens transparency and function.

C-Maf has been linked to multiple myeloma and juvenile idiopathic arthritis. c-Maf is often upregulated in multiple myeloma a cancer of plasma cells where it influences proliferation and survival of the malignant cells through its target genes like cyclin D2. Furthermore in juvenile idiopathic arthritis c-Maf contributes to the dysregulation of inflammatory cytokines indirectly involving proteins like IL-10 and IL-21. Understanding c-Maf’s function aids in exploring therapeutic targets for these diseases.

Specifications

Form

Liquid

General info

Function

Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells (By similarity). When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.

Sequence similarities

Belongs to the bZIP family. Maf subfamily.

Post-translational modifications

Ubiquitinated, leading to its degradation by the proteasome. Ubiquitination is triggered by glucocorticoids.. Phosphorylated by GSK3 and MAPK13 on serine and threonine residues (Probable). The phosphorylation status can serve to either stimulate or inhibit transcription.

Subcellular localisation

Nucleus

Product protocols

Target data

Acts as a transcriptional activator or repressor. Involved in embryonic lens fiber cell development. Recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. Activates the expression of IL4 in T helper 2 (Th2) cells. Increases T-cell susceptibility to apoptosis by interacting with MYB and decreasing BCL2 expression. Together with PAX6, transactivates strongly the glucagon gene promoter through the G1 element. Activates transcription of the CD13 proximal promoter in endothelial cells. Represses transcription of the CD13 promoter in early stages of myelopoiesis by affecting the ETS1 and MYB cooperative interaction. Involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. Binds to the sequence 5'-[GT]G[GC]N[GT]NCTCAGNN-3' in the L7 promoter. Binds to the T-MARE (Maf response element) sites of lens-specific alpha- and beta-crystallin gene promoters. Binds element G1 on the glucagon promoter. Binds an AT-rich region adjacent to the TGC motif (atypical Maf response element) in the CD13 proximal promoter in endothelial cells (By similarity). When overexpressed, represses anti-oxidant response element (ARE)-mediated transcription. Involved either as an oncogene or as a tumor suppressor, depending on the cell context. Binds to the ARE sites of detoxifying enzyme gene promoters.
See full target information MAF

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com