JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB224858

Recombinant Human C11B2/CYP11B2 protein (His tag)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human C11B2/CYP11B2 protein (His tag) is a Human Full Length protein, in the 25 to 503 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

Aldosterone synthase, Aldosterone-synthesizing enzyme, CYPXIB2, Cytochrome P-450Aldo, Cytochrome P-450C18, Steroid 18-hydroxylase, ALDOS, CYP11B2

1 Images
SDS-PAGE - Recombinant Human C11B2/CYP11B2 protein (His tag) (AB224858)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C11B2/CYP11B2 protein (His tag) (AB224858)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224858 with 5% enrichment gel and 15% separation gel.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P19099

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.2 - 7.4 Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as C11B2

Sequence info

[{"sequence":"GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN","proteinLength":"Full Length","predictedMolecularWeight":"71 kDa","actualMolecularWeight":null,"aminoAcidEnd":503,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P19099","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

C11B2 also known as CYP11B2 is a highly specific enzyme that plays an essential role in the biosynthesis of aldosterone. Also referred to as aldosterone synthase this cytochrome P450 family member is encoded by the CYP11B2 gene. It has a molecular mass of approximately 58 kDa. Its expression occurs mainly in the adrenal cortex particularly within the zona glomerulosa cells where it catalyzes the final steps in the production of aldosterone from cholesterol.
Biological function summary

CYP11B2 converts 11-deoxycorticosterone to corticosterone which is then converted to aldosterone. This enzyme functions independently and is not part of any larger protein complexes. It undertakes its role in the mitochondria of adrenal gland cells where it serves as an important factor in the corticosteroid synthesis pathway. Its activity is regulated via several factors including angiotensin II and potassium ion concentration to maintain homeostatic balance within the body.

Pathways

CYP11B2 is an integral part of the steroidogenic pathway specifically within the branch that leads to mineralocorticoid biosynthesis. This pathway involves the conversion of cholesterol to steroid hormones and is closely linked to the renin-angiotensin-aldosterone system (RAAS) which governs blood pressure and fluid balance. Besides its relationship with cholesterol side-chain cleavage enzyme (CYP11A1) CYP11B2 interacts with other proteins like 3-beta-hydroxysteroid dehydrogenase in facilitating steroidogenesis.

Abnormalities in CYP11B2 expression or function can lead to aldosterone-related conditions such as primary aldosteronism and Addison’s disease. Primary aldosteronism results from overproduction of aldosterone causing hypertension and electrolyte imbalances while its deficiency contributes to Addison's disease. These disorders can also involve connections with proteins like CYP17A1 which is another key player in steroid biosynthesis and whose disruptions can influence CYP11B2's activity or expression amplifying disease pathology.

Specifications

Form

Liquid

General info

Function

A cytochrome P450 monooxygenase that catalyzes the biosynthesis of aldosterone, the main mineralocorticoid in the human body responsible for salt and water homeostasis, thus involved in blood pressure regulation, arterial hypertension, and the development of heart failure (PubMed : 11856349, PubMed : 12530636, PubMed : 1518866, PubMed : 15356073, PubMed : 1594605, PubMed : 1775135, PubMed : 22446688, PubMed : 23322723, PubMed : 9814482, PubMed : 9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone (21-hydroxyprogesterone), namely 11-beta hydroxylation, followed by two successive oxidations at C18 yielding 18-hydroxy and then 18-oxo intermediates (that would not leave the enzyme active site during the consecutive hydroxylation reactions), ending with the formation of aldosterone (PubMed : 11856349, PubMed : 12530636, PubMed : 1518866, PubMed : 1594605, PubMed : 1775135, PubMed : 22446688, PubMed : 23322723, PubMed : 9814506). Can also produce 18-hydroxycortisol and 18-oxocortisol, derived from successive oxidations of cortisol at C18, normally found at very low levels, but significantly increased in primary aldosteronism, the most common form of secondary hypertension (PubMed : 15356073, PubMed : 9814482). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) (PubMed : 11856349, PubMed : 1594605, PubMed : 23322723, PubMed : 9814506). Could also be involved in the androgen metabolic pathway (Probable).

Sequence similarities

Belongs to the cytochrome P450 family.

Subcellular localisation

Mitochondrion inner membrane

Product protocols

Target data

A cytochrome P450 monooxygenase that catalyzes the biosynthesis of aldosterone, the main mineralocorticoid in the human body responsible for salt and water homeostasis, thus involved in blood pressure regulation, arterial hypertension, and the development of heart failure (PubMed : 11856349, PubMed : 12530636, PubMed : 1518866, PubMed : 15356073, PubMed : 1594605, PubMed : 1775135, PubMed : 22446688, PubMed : 23322723, PubMed : 9814482, PubMed : 9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone (21-hydroxyprogesterone), namely 11-beta hydroxylation, followed by two successive oxidations at C18 yielding 18-hydroxy and then 18-oxo intermediates (that would not leave the enzyme active site during the consecutive hydroxylation reactions), ending with the formation of aldosterone (PubMed : 11856349, PubMed : 12530636, PubMed : 1518866, PubMed : 1594605, PubMed : 1775135, PubMed : 22446688, PubMed : 23322723, PubMed : 9814506). Can also produce 18-hydroxycortisol and 18-oxocortisol, derived from successive oxidations of cortisol at C18, normally found at very low levels, but significantly increased in primary aldosteronism, the most common form of secondary hypertension (PubMed : 15356073, PubMed : 9814482). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) (PubMed : 11856349, PubMed : 1594605, PubMed : 23322723, PubMed : 9814506). Could also be involved in the androgen metabolic pathway (Probable).
See full target information Cytochrome P450 11B2, mitochondrial

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Acta physiologica (Oxford, England) 237:e13899 PubMed36264268

2022

Collecting duct renin regulates potassium homeostasis in mice.

Applications

Unspecified application

Species

Unspecified reactive species

Chuanming Xu,Yanting Chen,Nirupama Ramkumar,Chang-Jiang Zou,Curt D Sigmund,Tianxin Yang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com