JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177665

Recombinant Human C14orf126 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C14orf126 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 168 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C14orf126, DTD2, D-aminoacyl-tRNA deacylase 2, Animalia-specific tRNA deacylase, D-tyrosyl-tRNA(Tyr) deacylase 2, L-alanyl-tRNA deacylase, ATD

1 Images
SDS-PAGE - Recombinant Human C14orf126 protein (His tag N-Terminus) (AB177665)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C14orf126 protein (His tag N-Terminus) (AB177665)

15% SDS-PAGE : ab177665 used at 3μg

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q96FN9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF","proteinLength":"Full Length","predictedMolecularWeight":"21 kDa","actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q96FN9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

C14orf126 also known as FAM195A is an interesting protein with a molecular mass of about 14 kDa. Researchers have observed its expression across various tissues indicating a potentially broad functional role. The exact mechanical function of C14orf126 remains under investigation but current studies suggest it might play a role in cellular processes by interacting with other proteins or molecular complexes.
Biological function summary

C14orf126 is thought to be involved in cellular growth and maintenance. It appears to engage in interactions as part of cellular complexes which might assist in its functional activities. Studies indicate its possible involvement in the regulation of cellular homeostasis though detailed mechanisms are yet to be fully elucidated. Its presence across different tissues suggests it could act as a regulatory protein.

Pathways

Current evidence points to C14orf126 being part of regulatory networks such as the Wnt signaling pathway which is important for cell development and differentiation. It may have interplay with proteins like beta-catenin known for its role in the same pathway influencing gene transcription and cell fate decisions. C14orf126 might also have connections to the mTOR pathway associated with cell growth and proliferation suggesting potential importance in cellular metabolic regulation.

Scientists have connected C14orf126 to cancer and neurodegenerative diseases. Its potential role in cancer relates to its involvement in cell proliferation pathways linking it to proteins like p53 known for tumor suppression. In neurodegenerative diseases its association with neuronal survival proteins indicates it might affect neuron function and health. Understanding C14orf126's connections could lead to insights in therapeutic strategies for these conditions.

Specifications

Form

Liquid

Additional notes

Purified by using conventional chromatography techniques.

General info

Function

Deacylates mischarged D-aminoacyl-tRNAs (By similarity). Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS (By similarity). Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity). Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr) (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS (PubMed : 29410408). Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed : 29410408). Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation (By similarity).

Sequence similarities

Belongs to the DTD family.

Product protocols

Target data

Deacylates mischarged D-aminoacyl-tRNAs (By similarity). Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS (By similarity). Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids (By similarity). Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr) (By similarity). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS (PubMed : 29410408). Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site (PubMed : 29410408). Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation (By similarity).
See full target information DTD2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com