JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157982

Recombinant Human C1QA protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C1QA protein (GST tag N-Terminus) is a Human Full Length protein, in the 23 to 245 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Complement C1q subcomponent subunit A, C1QA

1 Images
SDS-PAGE - Recombinant Human C1QA protein (GST tag N-Terminus) (AB157982)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human C1QA protein (GST tag N-Terminus) (AB157982)

ab157982 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P02745

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":245,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02745","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The C1QA protein is one part of the complement component 1q (C1q) molecule also called C1Q-A. This protein plays an important role in the immune system. The C1q complex consists of three polypeptide chains: C1QA C1QB and C1QC. C1QA alone has a mass of around 26 kDa. These proteins mainly express in immune cells like macrophages dendritic cells and B cells. It forms part of the extracellular matrix where it participates in immune functions.
Biological function summary

C1QA interacts with pathogens and modified host cells to trigger the complement cascade. This starts the activation of the classical pathway which enhances immune responses. C1QA together with C1QB and C1QC binds to Fc regions of antibodies attached to antigens. This binding leads to the subsequent activation of C1r and C1s proteases facilitating opsonization and clearance of immune complexes and apoptotic cells.

Pathways

The synthesis of C1QA plays an important role in the classical complement pathway and is part of the innate immunity. C1QA collaborates with proteins like C1QB and C1QC in this pathway. This pathway bridges innate and adaptive immunity by assisting in the removal of pathogens and cell debris. It also relates to the coagulation pathway where its activity can influence inflammation and tissue repair processes.

Impaired C1QA function links to conditions like systemic lupus erythematosus (SLE) and rheumatoid arthritis. These diseases often associate with inappropriate activation or regulation of the complement system. C1QA mutations or deficiencies can result in a higher susceptibility to SLE and interactions with C1QB and C1QC are also implicated in this disease. Moreover C1QA influences the pathogenesis of rheumatoid arthritis by modulating inflammation responses.

Specifications

Form

Liquid

General info

Function

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).

Post-translational modifications

O-linked glycans are assumed to be the Glc-Gal disaccharides typically found as secondary modifications of hydroxylated lysines in collagen-like domains.

Product protocols

Target data

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).
See full target information C1QA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com