JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157983

Recombinant Human C1QB protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C1QB protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 253 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Complement C1q subcomponent subunit B, C1QB

1 Images
SDS-PAGE - Recombinant Human C1QB protein (GST tag N-Terminus) (AB157983)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C1QB protein (GST tag N-Terminus) (AB157983)

ab157983 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P02746

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":253,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02746","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

C1QB or complement component 1 q subcomponent beta chain is a protein that plays a mechanical role in the complement system. It has a mass of approximately 25 kDa and is expressed in many tissues including the liver and blood plasma. C1QB is a subunit of the C1q complex which is the first component of the classical complement pathway. This protein works with C1q's other subunits to recognize and bind to the Fc region of antibodies facilitating the activation of the complement pathway.
Biological function summary

C1QB is involved in the immune response and helps in the clearance of pathogens and apoptotic cells. It forms part of the C1q complex which includes two other components: C1QA and C1QC. This complex binds to antibodies that are attached to antigens on the surface of pathogens activating the C1r and C1s serine proteases. The activated enzymes then cleave other complement proteins triggering a cascade that results in opsonization inflammation and cell lysis.

Pathways

C1QB takes a significant role in the classical complement pathway and humoral immunity. The classical pathway starts with the binding of the C1 complex to antigen-antibody complexes. Through this mechanism C1QB associates with proteins such as C2 and C4 which further propagate the complement activation cascade. The classical complement pathway links to the lectin pathway where mannose-binding lectin substitutes for C1q to recognize pathogens.

Defects or deficiencies in C1QB relate to systemic lupus erythematosus (SLE) and hereditary angioedema. In SLE impaired function of C1QB leads to decreased clearance of immune complexes contributing to autoimmune reactions. This protein interacts with C1QA in disease mechanisms. In hereditary angioedema although C1QB is not directly defective its involvement in complement activation relates to mutations in C1 inhibitor protein. These mutations result in uncontrolled complement activation underlying the pathophysiology of the disorder.

Specifications

Form

Liquid

General info

Function

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).

Post-translational modifications

Hydroxylated on lysine and proline residues. Hydroxylated lysine residues can be glycosylated. Human C1Q contains up to 68.3 hydroxylysine-galactosylglucose residues and up to 2.5 hydroxylysine-galactose per molecule. Total percentage hydroxylysine residues glycosylated is 86.4%.

Product protocols

Target data

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).
See full target information C1QB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com