JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157984

Recombinant Human C1QC protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C1QC protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 245 aa range, expressed in Wheat germ, with >80%, suitable for ELISA, WB.

View Alternative Names

C1QG, C1QC, Complement C1q subcomponent subunit C

1 Images
SDS-PAGE - Recombinant Human C1QC protein (GST tag N-Terminus) (AB157984)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human C1QC protein (GST tag N-Terminus) (AB157984)

ab157984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Purity

>80%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P02747

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD","proteinLength":"Full Length","predictedMolecularWeight":"52.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":245,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02747","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

C1QC also known as complement component C1q subcomponent subunit C serves a mechanical role in the immune system. The C1QC protein with a molecular mass of about 26 kDa is primarily expressed in immune cells such as macrophages and dendritic cells. C1QC is part of the C1 complex which consists of C1q C1r and C1s subcomponents. This complex initiates the classical complement pathway by recognizing and binding to pathogens or apoptotic cells leading to their clearance from the body.
Biological function summary

C1QC is important for recognizing pathogens and apoptotic cells. C1QC is a part of the larger C1 complex essential for immune response effectiveness. By binding to surface molecules on pathogens C1QC triggers a cascade of events that promote cell lysis or phagocytosis. This protein by facilitating immune complex clearance also helps maintain tissue homeostasis and contributes to protection against infections.

Pathways

C1QC plays important roles in the classical complement pathway. Once C1QC identifies a target it activates C1r and C1s initiating a series of proteolytic interactions that result in the formation of the membrane attack complex. Additionally C1QC interacts with proteins like mannose-binding lectin in related pathways linking innate immunity components and further enhancing the body's defense mechanisms.

C1QC has connections to systemic lupus erythematosus (SLE) and Alzheimer's disease. Deficiencies or dysregulation of C1QC could lead to autoimmune conditions like SLE where the body attacks its own tissues due to inadequate clearance of apoptotic cells. In Alzheimer's disease impaired C1QC function may affect amyloid-beta clearance which is important for preventing neuronal damage. When discussing C1QC’s connections with other proteins the interaction with C1QA and C1QB within the C1 complex is significant in these disorders.

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose

General info

Function

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).

Post-translational modifications

O-linked glycans consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups.

Product protocols

Target data

Core component of the complement C1 complex, a multiprotein complex that initiates the classical pathway of the complement system, a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 34155115, PubMed : 6249812, PubMed : 6776418). The classical complement pathway is initiated by the C1Q subcomplex of the C1 complex, which specifically binds IgG or IgM immunoglobulins complexed with antigens, forming antigen-antibody complexes on the surface of pathogens : C1QA, together with C1QB and C1QC, specifically recognizes and binds the Fc regions of IgG or IgM via its C1q domain (PubMed : 12847249, PubMed : 19006321, PubMed : 24626930, PubMed : 29449492, PubMed : 3258649, PubMed : 6776418). Immunoglobulin-binding activates the proenzyme C1R, which cleaves C1S, initiating the proteolytic cascade of the complement system (PubMed : 29449492). The C1Q subcomplex is activated by a hexamer of IgG complexed with antigens, while it is activated by a pentameric IgM (PubMed : 19706439, PubMed : 24626930, PubMed : 29449492). The C1Q subcomplex also recognizes and binds phosphatidylserine exposed on the surface of cells undergoing programmed cell death, possibly promoting activation of the complement system (PubMed : 18250442).
See full target information C1QC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com