JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB157985

Recombinant Human C3 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human C3 protein (GST tag N-Terminus) is a Human Fragment protein, in the 1534 to 1644 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CPAMD1, C3, Complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1

1 Images
SDS-PAGE - Recombinant Human C3 protein (GST tag N-Terminus) (AB157985)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human C3 protein (GST tag N-Terminus) (AB157985)

ab157985 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P01024

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK","proteinLength":"Fragment","predictedMolecularWeight":"37.95 kDa","actualMolecularWeight":null,"aminoAcidEnd":1644,"aminoAcidStart":1534,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P01024","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Complement component 3 (C3) commonly known as C3 complement is a central protein in the complement system which plays a significant role in immune response. C3b a fragment of C3 is produced when C3 undergoes cleavage. C3 is a large protein with a mass of approximately 185 kDa. The liver primarily secretes C3 into the bloodstream. It circulates in the plasma and is found in high concentration making it one of the most abundant components of the complement system.
Biological function summary

Complement component C3 forms part of the innate immune system by promoting opsonization which enhances phagocytosis of pathogens. C3b binds to pathogens' surfaces facilitating their recognition by phagocytes. C3 as part of a complex with C3 convertase also has a role in amplifying the activation of the complement cascade. The proteolytic cleavage of C3 into C3b and C3a leads to the activation of other components forming the membrane attack complex and orchestrating inflammation.

Pathways

The complement component C3 functions within both the classical and alternative complement pathways. It acts as a convergence point where the complement activation pathways meet. C3 is activated into C3b and C3a which are key to amplifying the cascade. Furthermore C3 interacts with proteins such as factor B and factor D in the alternative pathway and C4 and C2 in the classical pathway facilitating the formation of C3 convertase necessary for pathway progression.

Complement C3 shows associations with immune-related and inflammatory diseases. Deficiencies or malfunctions of complement C3 can lead to increased susceptibility to infections due to impaired opsonization and clearance of pathogens. Additionally overactivation of the complement system involving C3 can contribute to autoimmune disorders such as systemic lupus erythematosus. Other proteins linked to these diseases include C4 in lupus and factor H in age-related macular degeneration which controls complement pathway activation.

Specifications

Form

Liquid

General info

Function

Precursor of non-enzymatic components of the classical, alternative, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C3b. Non-enzymatic component of C5 convertase (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448). Generated following cleavage by C3 convertase, it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448, PubMed : 833545, PubMed : 8349625). Complement C3b binds covalently via its reactive thioester, to cell surface carbohydrates or immune aggregates (PubMed : 6903192). Together with complement C4b, it then recruits the serine protease complement C2b to form the C5 convertase, which cleaves and activate C5, the next component of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864). In the alternative complement pathway, recruits the serine protease CFB to form the C5 convertase that cleaves and activates C5 (PubMed : 624565, PubMed : 6554279).. C3a anaphylatoxin. Mediator of local inflammatory process released following cleavage by C3 convertase (PubMed : 6968751, PubMed : 37169960, PubMed : 37852260). Acts by binding to its receptor, C3AR1, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C3AR1 (PubMed : 8702752, PubMed : 37169960, PubMed : 37852260). C3a anaphylatoxin stimulates the activation of immune cells such as mast cells and basophilic leukocytes to release inflammation agents, such as cytokines, chemokines and histamine, which promote inflammation development (PubMed : 23383423). Also acts as potent chemoattractant for the migration of macrophages and neutrophils to the inflamed tissues, resulting in neutralization of the inflammatory triggers by multiple ways, such as phagocytosis and generation of reactive oxidants (PubMed : 23383423, PubMed : 342601, PubMed : 5778786).. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial triglyceride clearance (PubMed : 10432298, PubMed : 15833747, PubMed : 16333141, PubMed : 19615750, PubMed : 2909530, PubMed : 8376604, PubMed : 9059512). Appears to stimulate triglyceride synthesis via activation of the PLC, MAPK and AKT signaling pathways (PubMed : 16333141). Acts by binding to its receptor, C5AR2, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C5AR2 (PubMed : 11773063, PubMed : 12540846, PubMed : 19615750). In contrast to C3a anaphylatoxin peptide, does not show pro-inflammatory activity (PubMed : 37852260).. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.

Post-translational modifications

C3 precursor is first processed by the removal of 4 Arg residues, forming two chains, beta and alpha, linked by a disulfide bond (PubMed:7240134). During activation of the complement systems, the alpha chain is cleaved into C3a and C3b by the C3 convertase: C3b stays linked to the beta chain, while C3a is released in the plasma (PubMed:6611150, PubMed:6906228). The alpha chain is cleaved by the serine protease complement C2b component of the C3 convertase to generate C3a and C3b following activation by the classical, lectin and GZMK complement systems (PubMed:39914456, PubMed:39814882, PubMed:6611150, PubMed:6906228). The alpha chain is cleaved by CFB component of the C3 convertase to generate C3a and C3b following activation by the alternative complement system (PubMed:28264884, PubMed:31507604, PubMed:3638964, PubMed:6919543, PubMed:9748277).. C3a anaphylatoxin. C3a is further processed by carboxypeptidases to release the C-terminal arginine residue generating the acylation stimulating protein (ASP) (PubMed:4098172, PubMed:6968751). Levels of ASP are increased in adipocytes in the postprandial period and by insulin and dietary chylomicrons (PubMed:15833747).. Complement C3b. Complement C3b is rapidly split in two positions by factor I (CFI) and a cofactor (CFH) to form iC3b (inactivated C3b) and C3f which is released (PubMed:17320177, PubMed:28671664, PubMed:7360115). CFI and CFH catalyze proteolytic degradation of already-deposited complement C3b (PubMed:28671664). Then iC3b is slowly cleaved (possibly by CFI) to form C3c (beta chain + alpha' chain fragment 1 + alpha' chain fragment 2), C3dg and C3f (PubMed:16177781, PubMed:17051150, PubMed:17684013). Other proteases produce other fragments such as C3d or C3g (PubMed:7539791).. Complement C3b. Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens.. Complement C3b. Complement C3b interacts with complement C4b via a thioester linkage.. Phosphorylated by FAM20C in the extracellular medium.. (Microbial infection) C3 is cleaved by Staphylococcus aureus aureolysin; this cleavage renders C3a and C3b inactive. C3b is rapidly degraded by host factors CFH and CFI preventing its deposition on the bacterial surface while C3a is further inactivated by aureolysin.. (Microbial infection) Complement C3 beta chain is cleaved and inactivated by S.pyogenes SpeB.. (Microbial infection) Cleaved by N.meningitidis NalP between Leu-744 and Gly-745, generating a slightly shorter C3 alpha form and a slightly longer C3 beta form. The C3b-like fragment is degraded in the presence of the complement regulators CFH and CFI, preventing its deposition on the bacterial surface.

Product protocols

Target data

Precursor of non-enzymatic components of the classical, alternative, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C3b. Non-enzymatic component of C5 convertase (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448). Generated following cleavage by C3 convertase, it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448, PubMed : 833545, PubMed : 8349625). Complement C3b binds covalently via its reactive thioester, to cell surface carbohydrates or immune aggregates (PubMed : 6903192). Together with complement C4b, it then recruits the serine protease complement C2b to form the C5 convertase, which cleaves and activate C5, the next component of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864). In the alternative complement pathway, recruits the serine protease CFB to form the C5 convertase that cleaves and activates C5 (PubMed : 624565, PubMed : 6554279).. C3a anaphylatoxin. Mediator of local inflammatory process released following cleavage by C3 convertase (PubMed : 6968751, PubMed : 37169960, PubMed : 37852260). Acts by binding to its receptor, C3AR1, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C3AR1 (PubMed : 8702752, PubMed : 37169960, PubMed : 37852260). C3a anaphylatoxin stimulates the activation of immune cells such as mast cells and basophilic leukocytes to release inflammation agents, such as cytokines, chemokines and histamine, which promote inflammation development (PubMed : 23383423). Also acts as potent chemoattractant for the migration of macrophages and neutrophils to the inflamed tissues, resulting in neutralization of the inflammatory triggers by multiple ways, such as phagocytosis and generation of reactive oxidants (PubMed : 23383423, PubMed : 342601, PubMed : 5778786).. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial triglyceride clearance (PubMed : 10432298, PubMed : 15833747, PubMed : 16333141, PubMed : 19615750, PubMed : 2909530, PubMed : 8376604, PubMed : 9059512). Appears to stimulate triglyceride synthesis via activation of the PLC, MAPK and AKT signaling pathways (PubMed : 16333141). Acts by binding to its receptor, C5AR2, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C5AR2 (PubMed : 11773063, PubMed : 12540846, PubMed : 19615750). In contrast to C3a anaphylatoxin peptide, does not show pro-inflammatory activity (PubMed : 37852260).. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.
See full target information C3

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in endocrinology 16:1523488 PubMed40099263

2025

Integrated multi-omics analysis reveals complement component 3 as a central driver of immune dysregulation in polycystic ovary syndrome.

Applications

Unspecified application

Species

Unspecified reactive species

Xuanpeng Zhao,Qingyan Meng,Shuang Liu,Linqi Cheng,Baoshan Li,Dongkai Cheng
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com