JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB288822

Recombinant Human C3 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human C3 protein is a Human Fragment protein, in the 672 to 747 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE.

View Alternative Names

CPAMD1, C3, Complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1

3 Images
Mass Spectrometry - Recombinant Human C3 protein (AB288822)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human C3 protein (AB288822)

Mass determination by ESI-TOF. Predicted MW is 8995.51 Da (+/-10 Da by ESI-TOF). Observed MW is 8995.36 Da.

HPLC - Recombinant Human C3 protein (AB288822)
  • HPLC

Supplier Data

HPLC - Recombinant Human C3 protein (AB288822)

HPLC analysis of ab288822

SDS-PAGE - Recombinant Human C3 protein (AB288822)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C3 protein (AB288822)

SDS-PAGE analysis of ab288822

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

Mass Spec, HPLC, SDS-PAGE

applications

Biologically active

No

Accession

P01024

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLA","proteinLength":"Fragment","predictedMolecularWeight":"9 kDa","actualMolecularWeight":"9 kDa","aminoAcidEnd":747,"aminoAcidStart":672,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01024","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Complement component 3 (C3) commonly known as C3 complement is a central protein in the complement system which plays a significant role in immune response. C3b a fragment of C3 is produced when C3 undergoes cleavage. C3 is a large protein with a mass of approximately 185 kDa. The liver primarily secretes C3 into the bloodstream. It circulates in the plasma and is found in high concentration making it one of the most abundant components of the complement system.
Biological function summary

Complement component C3 forms part of the innate immune system by promoting opsonization which enhances phagocytosis of pathogens. C3b binds to pathogens' surfaces facilitating their recognition by phagocytes. C3 as part of a complex with C3 convertase also has a role in amplifying the activation of the complement cascade. The proteolytic cleavage of C3 into C3b and C3a leads to the activation of other components forming the membrane attack complex and orchestrating inflammation.

Pathways

The complement component C3 functions within both the classical and alternative complement pathways. It acts as a convergence point where the complement activation pathways meet. C3 is activated into C3b and C3a which are key to amplifying the cascade. Furthermore C3 interacts with proteins such as factor B and factor D in the alternative pathway and C4 and C2 in the classical pathway facilitating the formation of C3 convertase necessary for pathway progression.

Complement C3 shows associations with immune-related and inflammatory diseases. Deficiencies or malfunctions of complement C3 can lead to increased susceptibility to infections due to impaired opsonization and clearance of pathogens. Additionally overactivation of the complement system involving C3 can contribute to autoimmune disorders such as systemic lupus erythematosus. Other proteins linked to these diseases include C4 in lupus and factor H in age-related macular degeneration which controls complement pathway activation.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Precursor of non-enzymatic components of the classical, alternative, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C3b. Non-enzymatic component of C5 convertase (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448). Generated following cleavage by C3 convertase, it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448, PubMed : 833545, PubMed : 8349625). Complement C3b binds covalently via its reactive thioester, to cell surface carbohydrates or immune aggregates (PubMed : 6903192). Together with complement C4b, it then recruits the serine protease complement C2b to form the C5 convertase, which cleaves and activate C5, the next component of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864). In the alternative complement pathway, recruits the serine protease CFB to form the C5 convertase that cleaves and activates C5 (PubMed : 624565, PubMed : 6554279).. C3a anaphylatoxin. Mediator of local inflammatory process released following cleavage by C3 convertase (PubMed : 6968751, PubMed : 37169960, PubMed : 37852260). Acts by binding to its receptor, C3AR1, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C3AR1 (PubMed : 8702752, PubMed : 37169960, PubMed : 37852260). C3a anaphylatoxin stimulates the activation of immune cells such as mast cells and basophilic leukocytes to release inflammation agents, such as cytokines, chemokines and histamine, which promote inflammation development (PubMed : 23383423). Also acts as potent chemoattractant for the migration of macrophages and neutrophils to the inflamed tissues, resulting in neutralization of the inflammatory triggers by multiple ways, such as phagocytosis and generation of reactive oxidants (PubMed : 23383423, PubMed : 342601, PubMed : 5778786).. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial triglyceride clearance (PubMed : 10432298, PubMed : 15833747, PubMed : 16333141, PubMed : 19615750, PubMed : 2909530, PubMed : 8376604, PubMed : 9059512). Appears to stimulate triglyceride synthesis via activation of the PLC, MAPK and AKT signaling pathways (PubMed : 16333141). Acts by binding to its receptor, C5AR2, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C5AR2 (PubMed : 11773063, PubMed : 12540846, PubMed : 19615750). In contrast to C3a anaphylatoxin peptide, does not show pro-inflammatory activity (PubMed : 37852260).. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.

Post-translational modifications

C3 precursor is first processed by the removal of 4 Arg residues, forming two chains, beta and alpha, linked by a disulfide bond (PubMed:7240134). During activation of the complement systems, the alpha chain is cleaved into C3a and C3b by the C3 convertase: C3b stays linked to the beta chain, while C3a is released in the plasma (PubMed:6611150, PubMed:6906228). The alpha chain is cleaved by the serine protease complement C2b component of the C3 convertase to generate C3a and C3b following activation by the classical, lectin and GZMK complement systems (PubMed:39914456, PubMed:39814882, PubMed:6611150, PubMed:6906228). The alpha chain is cleaved by CFB component of the C3 convertase to generate C3a and C3b following activation by the alternative complement system (PubMed:28264884, PubMed:31507604, PubMed:3638964, PubMed:6919543, PubMed:9748277).. C3a anaphylatoxin. C3a is further processed by carboxypeptidases to release the C-terminal arginine residue generating the acylation stimulating protein (ASP) (PubMed:4098172, PubMed:6968751). Levels of ASP are increased in adipocytes in the postprandial period and by insulin and dietary chylomicrons (PubMed:15833747).. Complement C3b. Complement C3b is rapidly split in two positions by factor I (CFI) and a cofactor (CFH) to form iC3b (inactivated C3b) and C3f which is released (PubMed:17320177, PubMed:28671664, PubMed:7360115). CFI and CFH catalyze proteolytic degradation of already-deposited complement C3b (PubMed:28671664). Then iC3b is slowly cleaved (possibly by CFI) to form C3c (beta chain + alpha' chain fragment 1 + alpha' chain fragment 2), C3dg and C3f (PubMed:16177781, PubMed:17051150, PubMed:17684013). Other proteases produce other fragments such as C3d or C3g (PubMed:7539791).. Complement C3b. Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens.. Complement C3b. Complement C3b interacts with complement C4b via a thioester linkage.. Phosphorylated by FAM20C in the extracellular medium.. (Microbial infection) C3 is cleaved by Staphylococcus aureus aureolysin; this cleavage renders C3a and C3b inactive. C3b is rapidly degraded by host factors CFH and CFI preventing its deposition on the bacterial surface while C3a is further inactivated by aureolysin.. (Microbial infection) Complement C3 beta chain is cleaved and inactivated by S.pyogenes SpeB.. (Microbial infection) Cleaved by N.meningitidis NalP between Leu-744 and Gly-745, generating a slightly shorter C3 alpha form and a slightly longer C3 beta form. The C3b-like fragment is degraded in the presence of the complement regulators CFH and CFI, preventing its deposition on the bacterial surface.

Product protocols

Target data

Precursor of non-enzymatic components of the classical, alternative, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C3b. Non-enzymatic component of C5 convertase (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448). Generated following cleavage by C3 convertase, it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (PubMed : 28264884, PubMed : 31507604, PubMed : 3653927, PubMed : 3897448, PubMed : 833545, PubMed : 8349625). Complement C3b binds covalently via its reactive thioester, to cell surface carbohydrates or immune aggregates (PubMed : 6903192). Together with complement C4b, it then recruits the serine protease complement C2b to form the C5 convertase, which cleaves and activate C5, the next component of the complement pathways (PubMed : 12878586, PubMed : 18204047, PubMed : 2387864). In the alternative complement pathway, recruits the serine protease CFB to form the C5 convertase that cleaves and activates C5 (PubMed : 624565, PubMed : 6554279).. C3a anaphylatoxin. Mediator of local inflammatory process released following cleavage by C3 convertase (PubMed : 6968751, PubMed : 37169960, PubMed : 37852260). Acts by binding to its receptor, C3AR1, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C3AR1 (PubMed : 8702752, PubMed : 37169960, PubMed : 37852260). C3a anaphylatoxin stimulates the activation of immune cells such as mast cells and basophilic leukocytes to release inflammation agents, such as cytokines, chemokines and histamine, which promote inflammation development (PubMed : 23383423). Also acts as potent chemoattractant for the migration of macrophages and neutrophils to the inflamed tissues, resulting in neutralization of the inflammatory triggers by multiple ways, such as phagocytosis and generation of reactive oxidants (PubMed : 23383423, PubMed : 342601, PubMed : 5778786).. Acylation stimulating protein. Adipogenic hormone that stimulates triglyceride synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial triglyceride clearance (PubMed : 10432298, PubMed : 15833747, PubMed : 16333141, PubMed : 19615750, PubMed : 2909530, PubMed : 8376604, PubMed : 9059512). Appears to stimulate triglyceride synthesis via activation of the PLC, MAPK and AKT signaling pathways (PubMed : 16333141). Acts by binding to its receptor, C5AR2, activating G protein-coupled receptor signaling, promoting the phosphorylation, ARRB2-mediated internalization and endocytosis of C5AR2 (PubMed : 11773063, PubMed : 12540846, PubMed : 19615750). In contrast to C3a anaphylatoxin peptide, does not show pro-inflammatory activity (PubMed : 37852260).. C3-beta-c. Acts as a chemoattractant for neutrophils in chronic inflammation.
See full target information C3

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

JCI insight 10: PubMed39964754

2025

Complement activation at the interface between adipocytes and cancer cells drives tumor progression.

Applications

Unspecified application

Species

Unspecified reactive species

Andres Valdivia,Ana Maria Isac,Horacio Cardenas,Guangyuan Zhao,Yaqi Zhang,Hao Huang,Jian-Jun Wei,Mauricio Cuello-Fredes,Sumie Kato,Fernán Gómez-Valenzuela,Francoise Gourronc,Aloysius Klingelhutz,Daniela Matei
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com