JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114287

Recombinant Human C4b protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C4b protein is a Human Fragment protein, in the 774 to 873 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CO4, CPAMD3, C4B_2, C4B, Complement C4-B, Basic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3

1 Images
SDS-PAGE - Recombinant Human C4b protein (AB114287)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human C4b protein (AB114287)

12.5% SDS-PAGE showing ab114287 at approximately 36.63kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

SDS-PAGE, WB, ELISA

applications

Biologically active

No

Accession

P0C0L5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":873,"aminoAcidStart":774,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P0C0L5","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The 'C4b' protein also known as the 'C4b complement' plays a significant role in the immune system. This protein is a part of the larger complement system specifically as a segment derived from the cleavage of the native 'C4 complement'. It has an estimated molecular mass of about 200 kDa. The 'C4b' protein is prominently expressed on the surface of cells and in body fluids where the immune response is active. As an important player in the complement pathway it binds covalently to foreign particles labeling them for destruction or removal by immune cells.
Biological function summary

The 'C4b complement' interacts with various other components of the immune system. It is particularly involved in the formation of the C3 and C5 convertase complexes which are essential for the opsonization and activation cascade leading to pathogen elimination. Its attachment to cellular surfaces provides a docking point for proteins such as C2 facilitating the further cleavage and progression of the complement cascade. This interaction is critical for driving the classical and lectin pathways of complement activation.

Pathways

The 'C4b protein' is integral to the classical pathway of complement activation as well as to the lectin pathway. It associates with proteins like C1s C1q and factor B forming complexes that execute various stages of immune defenses. By forming C3 and C5 convertase 'C4b' not only promotes phagocytosis but also inflammation and cell lysis through membrane attack complexes. These processes underlie the body's ability to address microbial invasions efficiently.

'C4b complement dysregulation' can lead to autoimmune conditions such as systemic lupus erythematosus (SLE) and type 1 diabetes. In SLE reduced or malfunctional 'C4b' increases susceptibility to infections and triggers inappropriate immune responses. It can also correlate with the deficiency of related proteins like C2 which further impairs the complement system. These associations indicate that proper regulation of 'C4b' is essential for maintaining immune system stability and preventing overactive immune responses.

Specifications

Form

Liquid

General info

Function

Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.. Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.

Post-translational modifications

Prior to secretion, the single-chain precursor is enzymatically cleaved to yield non-identical chains alpha, beta and gamma. During activation, the alpha chain is cleaved by C1 into C4a and C4b, and C4b stays linked to the beta and gamma chains. Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase. The proteolytic cleavages often are incomplete so that many structural forms can be found in plasma.

Product protocols

Target data

Non-enzymatic component of the C3 and C5 convertases and thus essential for the propagation of the classical complement pathway. Covalently binds to immunoglobulins and immune complexes and enhances the solubilization of immune aggregates and the clearance of IC through CR1 on erythrocytes. C4A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens, while C4B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens.. Derived from proteolytic degradation of complement C4, C4a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
See full target information C4B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com