JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198640

Recombinant Human C4d protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human C4d protein is a Human Full Length protein, in the 957 to 1336 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

CO4, CPAMD3, C4B_2, Complement C4-B, Basic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3

1 Images
SDS-PAGE - Recombinant Human C4d protein (AB198640)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human C4d protein (AB198640)

SDS PAGE analysis of ab198640, using BSA as a reference control protein. 4-20% gradient gel was used.

Lane 1 : 10μg BSA

Lane 2 : 5μg BSA

Lane 3 : 1μg BSA

Lane 4 : 10μl ab198640

Lane 5 : 5μl ab198640

Lane 6 : 1μl ab198640

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

T7 tag N-Terminus His tag N-Terminus TEV tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P0C0L5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR","proteinLength":"Full Length","predictedMolecularWeight":"43.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":1336,"aminoAcidStart":957,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0C0L4","tags":[{"tag":"T7","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"},{"tag":"TEV","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

C4d also known as the C4d complement is a degradation product of the complement component C4. It has a molecular weight of approximately 45 kDa. This protein is commonly expressed on the surfaces of endothelial cells in various tissues where it plays a role in the immune response. The presence of C4d on tissues is often detected using techniques like immunohistochemistry (IHC) also referred to as C4d IHC or C4d immunostain providing valuable insights into complement activation.
Biological function summary

The C4d protein acts as a marker for complement activation and is part of the larger complement cascade. C4d is primarily associated with the classical pathway and serves as an indicator of complement-mediated cell injury. The degradation of C4 into C4d is usually seen in immune responses where antibodies recognize antigens triggering sequence activation in the complement pathway. C4d's role as a marker facilitates the differentiation between antibody-mediated injury and other types of tissue damage.

Pathways

This complement protein gets involved in the classical pathway of the complement system which plays a critical role in innate and adaptive immunity. It is related to other proteins like C3 and C1q which are additional components within this pathway. These interactions are significant for the clearance of pathogens and also assist in enhancing the humoral immune response by promoting the deposition of complement on pathogenic surfaces.

C4d presence becomes particularly significant in conditions like transplant rejection and systemic lupus erythematosus (SLE). In transplant rejection its deposition on tissue samples might indicate antibody-mediated rejection where C4d binds to the tissue signaling an immune response against the transplanted organ. Additionally in SLE C4d's relation to other proteins such as C3 and C1q confirms its involvement in autoimmune responses where the immune system mistakenly targets the body's own tissues leading to chronic inflammation and damage.

Specifications

Form

Liquid

Additional notes

ab198640 was expressed in E.coli as inclusion bodies, refolded using unique “temperature shift inclusion body refolding” technology, chromatographically purified and sterile filtered.

General info

Function

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-B. Non-enzymatic component of C3 and C5 convertases (By similarity). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (By similarity). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 8538770). Complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens, while C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway). While it is strongly similar to anaphylatoxins, its role is unclear. Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays.

Post-translational modifications

Prior to secretion, the single-chain precursor is enzymatically cleaved by plasminogen (PLG) to yield non-identical chains alpha, beta and gamma (By similarity). During activation of the complement systems, the alpha chain is cleaved into C4a and C4b by different proteases depending on the complement pathway: C4b stays linked to the beta and gamma chains, while C4a is released in the plasma (By similarity). The alpha chain is cleaved by C1S to generate C4a and C4b following activation by the classical complement system (By similarity). The alpha chain is cleaved to generate C4a and C4b by MASP2 following activation by the lectin complement system (By similarity). The alpha chain is cleaved by GZMK to generate C4a and C4b following activation by the GZMK complement system (By similarity). Further degradation of C4b by C1 into the inactive fragments C4c and C4d blocks the generation of C3 convertase (By similarity). The proteolytic cleavages often are incomplete so that many structural forms can be found in plasma (By similarity).. Complement C4b-B. Upon activation, the internal thioester bond reacts with carbohydrate antigens on the target surface to form amide or ester bonds, leading to covalent association with the surface of pathogens.. Complement C4b-B. Complement C4b interacts with complement C3b via a thioester linkage.. N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

Product protocols

Target data

Precursor of non-enzymatic components of the classical, lectin and GZMK complement pathways, which consist in a cascade of proteins that leads to phagocytosis and breakdown of pathogens and signaling that strengthens the adaptive immune system.. Complement C4b-B. Non-enzymatic component of C3 and C5 convertases (By similarity). Generated following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway), it covalently attaches to the surface of pathogens, where it acts as an opsonin that marks the surface of antigens for removal (By similarity). It then recruits the serine protease complement C2b to form the C3 and C5 convertases, which cleave and activate C3 and C5, respectively, the next components of the complement pathways (PubMed : 8538770). Complement C4b-B isotype catalyzes the transacylation of the thioester carbonyl group to form ester bonds with carbohydrate antigens, while C4b-A isotype is responsible for effective binding to form amide bonds with immune aggregates or protein antigens (PubMed : 8538770).. C4a anaphylatoxin. Putative humoral mediator released following cleavage by complement proteases (C1S, MASP2 or GZMK, depending on the complement pathway). While it is strongly similar to anaphylatoxins, its role is unclear. Was reported to act as a mediator of local inflammatory process; however these effects were probably due to contamination with C3a and/C5a anaphylatoxins in biological assays.
See full target information C4B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com