JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101870

Recombinant Human Calcineurin A protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Calcineurin A protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 511 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, WB.

View Alternative Names

CALNA, CNA, PPP3CA, Protein phosphatase 3 catalytic subunit alpha, CAM-PRP catalytic subunit, Calcineurin A alpha, Calmodulin-dependent calcineurin A subunit alpha isoform, Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform, CNA alpha

3 Images
Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)
  • WB

Unknown

Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)

All lanes:

Western blot - Anti-Calcineurin A antibody (<a href='/en-us/products/primary-antibodies/calcineurin-a-antibody-ab3673'>ab3673</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (ab101870) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 59 kDa

true

Exposure time: 10s

Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)
  • WB

Unknown

Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)

All lanes:

Western blot - Anti-Calcineurin A antibody (<a href='/en-us/products/primary-antibodies/calcineurin-a-antibody-ab3673'>ab3673</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human Calcineurin A protein (His tag N-Terminus) (ab101870) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 59 kDa

true

Exposure time: 10s

SDS-PAGE - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Calcineurin A protein (His tag N-Terminus) (AB101870)

15% SDS PAGE analysis of 3μg ab101870.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, WB

applications

Biologically active

No

Accession

Q08209

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride, 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.0292% EDTA

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab101870 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/calcineurin-a-antibody-ab3673'>ab3673</a>.</p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ","proteinLength":"Full Length","predictedMolecularWeight":"60 kDa","actualMolecularWeight":null,"aminoAcidEnd":511,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q08209","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Calcineurin A also known as PPP3CA is a highly specific protein phosphatase with a pivotal role in cellular signaling. It has a molecular mass of approximately 59 to 61 kDa depending on the isoform. Calcineurin A expression occurs in various tissues including the brain immune cells and cardiac tissues. It acts as the catalytic subunit of the enzyme calcineurin and is important for its function.
Biological function summary

Calcineurin A participates in numerous cellular processes through its phosphatase activity. As part of the calcineurin complex which includes a regulatory subunit it modulates the dephosphorylation of target proteins. This activity enables Calcineurin A to influence activation of T-lymphocytes by dephosphorylating the nuclear factor of activated T-cells (NFAT) a transcription factor responsible for immune response. Calcineurin A also plays a role in neuronal signaling and muscle function.

Pathways

Calcineurin A engages in the calcium signaling pathway which is vital for diverse cellular functions. It is related to proteins like calmodulin which binds calcium ions to activate Calcineurin A. Another important pathway includes the MAPK signaling pathway where Calcineurin A influences various cellular outcomes by regulating different transcription factors. Through these pathways Calcineurin A integrates signals that affect cellular growth survival and differentiation.

Calcineurin A is associated with cardiac hypertrophy and immunosuppressive conditions. In cardiac hypertrophy aberrant Calcineurin A activity leads to changes in heart muscle size and function. The protein also connects to the disorder of immunosuppression through its inhibition by drugs like cyclosporine which are used to prevent transplant rejection by targeting Calcineurin A. This inhibition blocks T-cell activation and provides therapeutic benefits in managing transplant patients.

Specifications

Form

Liquid

Additional notes

ab101870 was purified using conventional chromatography techniques.

General info

Function

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed : 15671020, PubMed : 18838687, PubMed : 19154138, PubMed : 23468591, PubMed : 30254215). Many of the substrates contain a PxIxIT motif and/or a LxVP motif (PubMed : 17498738, PubMed : 17502104, PubMed : 22343722, PubMed : 23468591, PubMed : 27974827). In response to increased Ca(2+) levels, dephosphorylates and activates phosphatase SSH1 which results in cofilin dephosphorylation (PubMed : 15671020). In response to increased Ca(2+) levels following mitochondrial depolarization, dephosphorylates DNM1L inducing DNM1L translocation to the mitochondrion (PubMed : 18838687). Positively regulates the CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals (By similarity). Dephosphorylates heat shock protein HSPB1 (By similarity). Dephosphorylates and activates transcription factor NFATC1 (PubMed : 19154138). In response to increased Ca(2+) levels, regulates NFAT-mediated transcription probably by dephosphorylating NFAT and promoting its nuclear translocation (PubMed : 26248042). Dephosphorylates and inactivates transcription factor ELK1 (PubMed : 19154138). Dephosphorylates DARPP32 (PubMed : 19154138). May dephosphorylate CRTC2 at 'Ser-171' resulting in CRTC2 dissociation from 14-3-3 proteins (PubMed : 30611118). Dephosphorylates transcription factor TFEB at 'Ser-211' following Coxsackievirus B3 infection, promoting nuclear translocation (PubMed : 33691586). Required for postnatal development of the nephrogenic zone and superficial glomeruli in the kidneys, cell cycle homeostasis in the nephrogenic zone, and ultimately normal kidney function (By similarity). Plays a role in intracellular AQP2 processing and localization to the apical membrane in the kidney, may thereby be required for efficient kidney filtration (By similarity). Required for secretion of salivary enzymes amylase, peroxidase, lysozyme and sialic acid via formation of secretory vesicles in the submandibular glands (By similarity). Required for calcineurin activity and homosynaptic depotentiation in the hippocampus (By similarity). Required for normal differentiation and survival of keratinocytes and therefore required for epidermis superstructure formation (By similarity). Positively regulates osteoblastic bone formation, via promotion of osteoblast differentiation (By similarity). Positively regulates osteoclast differentiation, potentially via NFATC1 signaling (By similarity). May play a role in skeletal muscle fiber type specification, potentially via NFATC1 signaling (By similarity). Negatively regulates MAP3K14/NIK signaling via inhibition of nuclear translocation of the transcription factors RELA and RELB (By similarity). Required for antigen-specific T-cell proliferation response (By similarity). Dephosphorylates KLHL3, promoting the interaction between KLHL3 and WNK4 and subsequent degradation of WNK4 (PubMed : 30718414). Negatively regulates SLC9A1 activity (PubMed : 31375679).

Sequence similarities

Belongs to the PPP phosphatase family. PP-2B subfamily.

Product protocols

Target data

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed : 15671020, PubMed : 18838687, PubMed : 19154138, PubMed : 23468591, PubMed : 30254215). Many of the substrates contain a PxIxIT motif and/or a LxVP motif (PubMed : 17498738, PubMed : 17502104, PubMed : 22343722, PubMed : 23468591, PubMed : 27974827). In response to increased Ca(2+) levels, dephosphorylates and activates phosphatase SSH1 which results in cofilin dephosphorylation (PubMed : 15671020). In response to increased Ca(2+) levels following mitochondrial depolarization, dephosphorylates DNM1L inducing DNM1L translocation to the mitochondrion (PubMed : 18838687). Positively regulates the CACNA1B/CAV2.2-mediated Ca(2+) release probability at hippocampal neuronal soma and synaptic terminals (By similarity). Dephosphorylates heat shock protein HSPB1 (By similarity). Dephosphorylates and activates transcription factor NFATC1 (PubMed : 19154138). In response to increased Ca(2+) levels, regulates NFAT-mediated transcription probably by dephosphorylating NFAT and promoting its nuclear translocation (PubMed : 26248042). Dephosphorylates and inactivates transcription factor ELK1 (PubMed : 19154138). Dephosphorylates DARPP32 (PubMed : 19154138). May dephosphorylate CRTC2 at 'Ser-171' resulting in CRTC2 dissociation from 14-3-3 proteins (PubMed : 30611118). Dephosphorylates transcription factor TFEB at 'Ser-211' following Coxsackievirus B3 infection, promoting nuclear translocation (PubMed : 33691586). Required for postnatal development of the nephrogenic zone and superficial glomeruli in the kidneys, cell cycle homeostasis in the nephrogenic zone, and ultimately normal kidney function (By similarity). Plays a role in intracellular AQP2 processing and localization to the apical membrane in the kidney, may thereby be required for efficient kidney filtration (By similarity). Required for secretion of salivary enzymes amylase, peroxidase, lysozyme and sialic acid via formation of secretory vesicles in the submandibular glands (By similarity). Required for calcineurin activity and homosynaptic depotentiation in the hippocampus (By similarity). Required for normal differentiation and survival of keratinocytes and therefore required for epidermis superstructure formation (By similarity). Positively regulates osteoblastic bone formation, via promotion of osteoblast differentiation (By similarity). Positively regulates osteoclast differentiation, potentially via NFATC1 signaling (By similarity). May play a role in skeletal muscle fiber type specification, potentially via NFATC1 signaling (By similarity). Negatively regulates MAP3K14/NIK signaling via inhibition of nuclear translocation of the transcription factors RELA and RELB (By similarity). Required for antigen-specific T-cell proliferation response (By similarity). Dephosphorylates KLHL3, promoting the interaction between KLHL3 and WNK4 and subsequent degradation of WNK4 (PubMed : 30718414). Negatively regulates SLC9A1 activity (PubMed : 31375679).
See full target information PPP3CA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com