JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177726

Recombinant Human CAMK2N1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CAMK2N1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 78 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Calcium/calmodulin-dependent protein kinase II inhibitor 1, CaMKII inhibitory protein alpha, CaMKIIN-alpha, CAMK2N1

1 Images
SDS-PAGE - Recombinant Human CAMK2N1 protein (His tag N-Terminus) (AB177726)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CAMK2N1 protein (His tag N-Terminus) (AB177726)

15% SDS-PAGE analysis of ab177726 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q7Z7J9

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV","proteinLength":"Full Length","predictedMolecularWeight":"10.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":78,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q7Z7J9","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CAMK2N1 also known as calcium/calmodulin-dependent protein kinase II inhibitor 1 is a small protein with a molecular weight of approximately 8 kDa. It acts as a natural inhibitor of the CaMKII enzyme an important kinase involved in calcium signaling. CAMK2N1 binds to the CaMKII holoenzyme inhibiting its activity by blocking its substrate access. The protein is mainly expressed in the brain particularly in regions such as the hippocampus where calcium signaling plays a critical role in neuronal plasticity.
Biological function summary

CAMK2N1 influences calcium-mediated neuronal signaling by regulating CaMKII activity. It does not act alone; instead it is part of a larger signaling complex that modulates synaptic strength and plasticity. Its inhibitory action on CaMKII affects processes associated with learning and memory by controlling the extent of phosphorylation events at synapses. As a result CAMK2N1 has an important role in maintaining neuronal function and homeostasis.

Pathways

CAMK2N1 is significant in the calcium signaling pathway and the long-term potentiation pathway. By modulating CaMKII activity CAMK2N1 influences various downstream events including the phosphorylation of target proteins such as CREB and synapsin. These events are essential for synaptic plasticity and memory formation. The regulation of CaMKII by CAMK2N1 along with its interaction with other kinases and phosphatases integrates signals that are necessary for synaptic modification.

CAMK2N1 has been linked to neurological conditions like Alzheimer's disease and schizophrenia. In Alzheimer’s disease dysregulation of calcium signaling and impaired synaptic plasticity are observed connecting CAMK2N1 and CaMKII activities to the disease's progression. Similarly in schizophrenia alterations in synaptic function and signaling have been noted involving CAMK2N1’s regulation of CaMKII. The interplay between CAMK2N1 and other proteins in these pathways such as tau in Alzheimer's and dopamine receptors in schizophrenia highlights its potential role in these disorders.

Specifications

Form

Liquid

General info

Function

Potent and specific inhibitor of CaM-kinase II (CAMK2) (By similarity). Plays a role in the maintenance of long-term retrieval-induced memory in response to contextual fear (By similarity). Modulates blood pressure and vascular reactivity via regulation of CAMK2 activity in addition to regulation of left ventricular mass (By similarity). Mediates the NLRP3 inflammasome in cardiomyocytes via acting as an inhibitor of the MAPK14/p38 and MAPK8/JNK pathways, thereby regulating ventricular remodeling and cardiac rhythm post-myocardial infarction (By similarity). Negatively effects insulin sensitivity and promotes lipid formation in adipose tissues independent of CAMK2 signaling (By similarity).

Sequence similarities

Belongs to the CAMK2N family.

Product protocols

Target data

Potent and specific inhibitor of CaM-kinase II (CAMK2) (By similarity). Plays a role in the maintenance of long-term retrieval-induced memory in response to contextual fear (By similarity). Modulates blood pressure and vascular reactivity via regulation of CAMK2 activity in addition to regulation of left ventricular mass (By similarity). Mediates the NLRP3 inflammasome in cardiomyocytes via acting as an inhibitor of the MAPK14/p38 and MAPK8/JNK pathways, thereby regulating ventricular remodeling and cardiac rhythm post-myocardial infarction (By similarity). Negatively effects insulin sensitivity and promotes lipid formation in adipose tissues independent of CAMK2 signaling (By similarity).
See full target information Calcium/calmodulin-dependent protein kinase II inhibitor 1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com