JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB241237

Recombinant Human Caspase-1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Caspase-1 protein (Tagged) is a Human Fragment protein, in the 120 to 269 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

IL1BC, IL1BCE, CASP1, Caspase-1, CASP-1, Interleukin-1 beta convertase, Interleukin-1 beta-converting enzyme, p45, IL-1BC, ICE, IL-1 beta-converting enzyme

1 Images
SDS-PAGE - Recombinant Human Caspase-1 protein (Tagged) (AB241237)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Caspase-1 protein (Tagged) (AB241237)

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab241237.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P29466

Animal free

No

Carrier free

No

Species

Human

Storage buffer

Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN","proteinLength":"Fragment","predictedMolecularWeight":"43.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":269,"aminoAcidStart":120,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P29466","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 26375003, PubMed : 32051255, PubMed : 37993714, PubMed : 7876192, PubMed : 9334240). Plays a key role in cell immunity as an inflammatory response initiator : once activated through formation of an inflammasome complex, it initiates a pro-inflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 32051255, PubMed : 7876192). Cleaves a tetrapeptide after an Asp residue at position P1 (PubMed : 15498465, PubMed : 1574116, PubMed : 7876192). Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD (PubMed : 26375003). In contrast to cleavage of interleukin IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part (PubMed : 32051255, PubMed : 32109412, PubMed : 32553275). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (PubMed : 22464733). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed : 28314590). In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly (PubMed : 20197547).. Isoform Delta. Apoptosis inactive.. Isoform Epsilon. Apoptosis inactive.

Sequence similarities

Belongs to the peptidase C14A family.

Post-translational modifications

The two subunits are derived from the precursor sequence by an autocatalytic mechanism.. Ubiquitinated via 'Lys-11'-linked polyubiquitination. Deubiquitinated by USP8.. Cleavage in the interdomain linker region is required to induce pyroptosis.

Product protocols

Target data

Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 26375003, PubMed : 32051255, PubMed : 37993714, PubMed : 7876192, PubMed : 9334240). Plays a key role in cell immunity as an inflammatory response initiator : once activated through formation of an inflammasome complex, it initiates a pro-inflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes (PubMed : 15326478, PubMed : 15498465, PubMed : 1574116, PubMed : 32051255, PubMed : 7876192). Cleaves a tetrapeptide after an Asp residue at position P1 (PubMed : 15498465, PubMed : 1574116, PubMed : 7876192). Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD (PubMed : 26375003). In contrast to cleavage of interleukin IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part (PubMed : 32051255, PubMed : 32109412, PubMed : 32553275). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (PubMed : 22464733). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed : 28314590). In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly (PubMed : 20197547).. Isoform Delta. Apoptosis inactive.. Isoform Epsilon. Apoptosis inactive.
See full target information CASP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com