JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198478

Recombinant human Caspase-7 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Caspase-7 protein (His tag C-Terminus) is a Human Full Length protein, in the 1 to 303 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

MCH3, CASP7, Caspase-7, CASP-7, Apoptotic protease Mch-3, CMH-1, ICE-like apoptotic protease 3, ICE-LAP3

2 Images
Functional Studies - Recombinant human Caspase-7 protein (His tag C-Terminus) (AB198478)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Caspase-7 protein (His tag C-Terminus) (AB198478)

Example of specific activity of ab198478

SDS-PAGE - Recombinant human Caspase-7 protein (His tag C-Terminus) (AB198478)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Caspase-7 protein (His tag C-Terminus) (AB198478)

4-20% SDS-PAGE analysis of ab198478 with Coomassie staining.

Lane 1 : 4.56 μg ab198478 (subunits 1 + 2)
Lane 2 : Protein marker

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Specific Activity: ≥ 5337 pmol/min/μg

Accession

P55210

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 1.05% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQHHHHHH","proteinLength":"Full Length","predictedMolecularWeight":"35.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":303,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P55210","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

General info

Function

Thiol protease involved in different programmed cell death processes, such as apoptosis, pyroptosis or granzyme-mediated programmed cell death, by proteolytically cleaving target proteins (PubMed : 11257230, PubMed : 11257231, PubMed : 11701129, PubMed : 15314233, PubMed : 16916640, PubMed : 17646170, PubMed : 18723680, PubMed : 19581639, PubMed : 8521391, PubMed : 8567622, PubMed : 8576161, PubMed : 9070923). Has a marked preference for Asp-Glu-Val-Asp (DEVD) consensus sequences, with some plasticity for alternate non-canonical sequences (PubMed : 12824163, PubMed : 15314233, PubMed : 17697120, PubMed : 19581639, PubMed : 20566630, PubMed : 23650375, PubMed : 23897474, PubMed : 27032039). Its involvement in the different programmed cell death processes is probably determined by upstream proteases that activate CASP7 (By similarity). Acts as an effector caspase involved in the execution phase of apoptosis : following cleavage and activation by initiator caspases (CASP8, CASP9 and/or CASP10), mediates execution of apoptosis by catalyzing cleavage of proteins, such as CLSPN, PARP1, PTGES3 and YY1 (PubMed : 10497198, PubMed : 16123041, PubMed : 16374543, PubMed : 16916640, PubMed : 18723680, PubMed : 20566630, PubMed : 21555521, PubMed : 22184066, PubMed : 22451931, PubMed : 27889207, PubMed : 28863261, PubMed : 31586028, PubMed : 34156061, PubMed : 35338844, PubMed : 35446120). Compared to CASP3, acts as a minor executioner caspase and cleaves a limited set of target proteins (PubMed : 18723680). Acts as a key regulator of the inflammatory response in response to bacterial infection by catalyzing cleavage and activation of the sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, thereby promoting membrane repair (PubMed : 21157428). Regulates pyroptosis in intestinal epithelial cells : cleaved and activated by CASP1 in response to S.typhimurium infection, promoting its secretion to the extracellular milieu, where it catalyzes activation of SMPD1, generating ceramides that repair membranes and counteract the action of gasdermin-D (GSDMD) pores (By similarity). Regulates granzyme-mediated programmed cell death in hepatocytes : cleaved and activated by granzyme B (GZMB) in response to bacterial infection, promoting its secretion to the extracellular milieu, where it catalyzes activation of SMPD1, generating ceramides that repair membranes and counteract the action of perforin (PRF1) pores (By similarity). Following cleavage by CASP1 in response to inflammasome activation, catalyzes processing and inactivation of PARP1, alleviating the transcription repressor activity of PARP1 (PubMed : 22464733). Acts as an inhibitor of type I interferon production during virus-induced apoptosis by mediating cleavage of antiviral proteins CGAS, IRF3 and MAVS, thereby preventing cytokine overproduction (By similarity). Cleaves and activates sterol regulatory element binding proteins (SREBPs) (PubMed : 8643593). Cleaves phospholipid scramblase proteins XKR4, XKR8 and XKR9 (By similarity). In case of infection, catalyzes cleavage of Kaposi sarcoma-associated herpesvirus protein ORF57, thereby preventing expression of viral lytic genes (PubMed : 20159985). Cleaves BIRC6 following inhibition of BIRC6-caspase binding by DIABLO/SMAC (PubMed : 36758104, PubMed : 36758106).. Isoform Beta. Lacks enzymatic activity.

Sequence similarities

Belongs to the peptidase C14A family.

Post-translational modifications

Cleavage by different proteases, such as granzyme B (GZMB), caspase-1 (CASP1), caspase-8 (CASP8), caspase-9 (CASP9) or caspase-10 (CASP10) generate the two active subunits (PubMed:12824163, PubMed:16352606, PubMed:16916640, PubMed:35338844, PubMed:35446120, PubMed:9852092). Its involvement in different programmed cell death processes is probably specified by the protease that activates CASP7 (PubMed:16916640, PubMed:9852092). Cleaved and activated by initiator caspases (CASP8, CASP9 and/or CASP10), leading to execution phase of apoptosis (PubMed:16352606, PubMed:16916640, PubMed:21555521, PubMed:27889207). Cleavage and maturation by GZMB regulates granzyme-mediated programmed cell death (By similarity). Cleaved and activated by CASP1 in response to bacterial infection (By similarity). Propeptide domains can also be cleaved efficiently by CASP3 (PubMed:8755496). Active heterodimers between the small subunit of caspase-7 and the large subunit of CASP3, and vice versa, also occur (PubMed:8755496). Also cleaved at the N-terminus at alternative sites by CAPN1, leading to its activation (PubMed:19617626).. Phosphorylation at Ser-30 and Ser-239 by PAK2 inhibits its activity (PubMed:21555521, PubMed:27889207). Phosphorylation at Ser-30 prevents cleavage and activation by initiator caspase CASP9, while phosphorylation at Ser-239 prevents thiol protease activity by preventing substrate-binding (PubMed:21555521, PubMed:27889207).. (Microbial infection) ADP-riboxanation by C.violaceum CopC blocks CASP7 processing, preventing CASP7 activation and ability to recognize and cleave substrates.. Ubiquitinated by BIRC6; this activity is inhibited by DIABLO/SMAC.

Product protocols

Target data

Thiol protease involved in different programmed cell death processes, such as apoptosis, pyroptosis or granzyme-mediated programmed cell death, by proteolytically cleaving target proteins (PubMed : 11257230, PubMed : 11257231, PubMed : 11701129, PubMed : 15314233, PubMed : 16916640, PubMed : 17646170, PubMed : 18723680, PubMed : 19581639, PubMed : 8521391, PubMed : 8567622, PubMed : 8576161, PubMed : 9070923). Has a marked preference for Asp-Glu-Val-Asp (DEVD) consensus sequences, with some plasticity for alternate non-canonical sequences (PubMed : 12824163, PubMed : 15314233, PubMed : 17697120, PubMed : 19581639, PubMed : 20566630, PubMed : 23650375, PubMed : 23897474, PubMed : 27032039). Its involvement in the different programmed cell death processes is probably determined by upstream proteases that activate CASP7 (By similarity). Acts as an effector caspase involved in the execution phase of apoptosis : following cleavage and activation by initiator caspases (CASP8, CASP9 and/or CASP10), mediates execution of apoptosis by catalyzing cleavage of proteins, such as CLSPN, PARP1, PTGES3 and YY1 (PubMed : 10497198, PubMed : 16123041, PubMed : 16374543, PubMed : 16916640, PubMed : 18723680, PubMed : 20566630, PubMed : 21555521, PubMed : 22184066, PubMed : 22451931, PubMed : 27889207, PubMed : 28863261, PubMed : 31586028, PubMed : 34156061, PubMed : 35338844, PubMed : 35446120). Compared to CASP3, acts as a minor executioner caspase and cleaves a limited set of target proteins (PubMed : 18723680). Acts as a key regulator of the inflammatory response in response to bacterial infection by catalyzing cleavage and activation of the sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, thereby promoting membrane repair (PubMed : 21157428). Regulates pyroptosis in intestinal epithelial cells : cleaved and activated by CASP1 in response to S.typhimurium infection, promoting its secretion to the extracellular milieu, where it catalyzes activation of SMPD1, generating ceramides that repair membranes and counteract the action of gasdermin-D (GSDMD) pores (By similarity). Regulates granzyme-mediated programmed cell death in hepatocytes : cleaved and activated by granzyme B (GZMB) in response to bacterial infection, promoting its secretion to the extracellular milieu, where it catalyzes activation of SMPD1, generating ceramides that repair membranes and counteract the action of perforin (PRF1) pores (By similarity). Following cleavage by CASP1 in response to inflammasome activation, catalyzes processing and inactivation of PARP1, alleviating the transcription repressor activity of PARP1 (PubMed : 22464733). Acts as an inhibitor of type I interferon production during virus-induced apoptosis by mediating cleavage of antiviral proteins CGAS, IRF3 and MAVS, thereby preventing cytokine overproduction (By similarity). Cleaves and activates sterol regulatory element binding proteins (SREBPs) (PubMed : 8643593). Cleaves phospholipid scramblase proteins XKR4, XKR8 and XKR9 (By similarity). In case of infection, catalyzes cleavage of Kaposi sarcoma-associated herpesvirus protein ORF57, thereby preventing expression of viral lytic genes (PubMed : 20159985). Cleaves BIRC6 following inhibition of BIRC6-caspase binding by DIABLO/SMAC (PubMed : 36758104, PubMed : 36758106).. Isoform Beta. Lacks enzymatic activity.
See full target information CASP7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com