JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198070

Recombinant human Caspase-8 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human Caspase-8 protein (His tag C-Terminus) is a Human Fragment protein, in the 200 to 496 aa range, expressed in Escherichia coli, with >99%, suitable for SDS-PAGE, FuncS.

View Alternative Names

MCH5, CASP8, Caspase-8, CASP-8, Apoptotic cysteine protease, Apoptotic protease Mch-5, CAP4, FADD-homologous ICE/ced-3-like protease, FADD-like ICE, ICE-like apoptotic protease 5, MORT1-associated ced-3 homolog, FLICE, MACH

2 Images
Functional Studies - Recombinant human Caspase-8 protein (His tag C-Terminus) (AB198070)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Caspase-8 protein (His tag C-Terminus) (AB198070)

Example of specific activity of ab198070.

SDS-PAGE - Recombinant human Caspase-8 protein (His tag C-Terminus) (AB198070)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Caspase-8 protein (His tag C-Terminus) (AB198070)

4-20% SDS-PAGE analysis of ab198070 (7 μg) with Coomassie staining.

Key facts

Purity

>99% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: ≥ 1145 pmol/min/μg

Accession

Q14790

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Preservative: 1.36% Imidazole Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Peptide notes: Autocleaved between the prodomain and large protease subunit (p18). The cleavage product, p30, contains both the large (p18) and small (p10 [His-tag]) protease subunits. p30 is further processed to the p18 and p10 subunits, which dimerize to form active enzyme.

Sequence info

[{"sequence":"MNKSLLKIINDYEEFSKGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSDHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"34.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":496,"aminoAcidStart":200,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q14790","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

General info

Function

Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood (PubMed : 23516580, PubMed : 35338844, PubMed : 35446120, PubMed : 8681376, PubMed : 8681377, PubMed : 8962078, PubMed : 9006941, PubMed : 9184224). Initiator protease that induces extrinsic apoptosis by mediating cleavage and activation of effector caspases responsible for FAS/CD95-mediated and TNFRSF1A-induced cell death (PubMed : 23516580, PubMed : 35338844, PubMed : 35446120, PubMed : 8681376, PubMed : 8681377, PubMed : 8962078, PubMed : 9006941, PubMed : 9184224). Cleaves and activates effector caspases CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10 (PubMed : 16916640, PubMed : 8962078, PubMed : 9006941). Binding to the adapter molecule FADD recruits it to either receptor FAS/TNFRSF6 or TNFRSF1A (PubMed : 8681376, PubMed : 8681377). The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation (PubMed : 9184224). The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases (PubMed : 9184224). Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC (PubMed : 9184224). Also cleaves and activates BID, thereby promoting cytochrome C release from mitochrondria (By similarity). In addition to extrinsic apoptosis, also acts as a negative regulator of necroptosis : acts by cleaving RIPK1 at 'Asp-324', which is crucial to inhibit RIPK1 kinase activity, limiting TNF-induced apoptosis, necroptosis and inflammatory response (PubMed : 31827280, PubMed : 31827281). Also able to initiate pyroptosis by mediating cleavage and activation of gasdermin-C and -D (GSDMC and GSDMD, respectively) : gasdermin cleavage promotes release of the N-terminal moiety that binds to membranes and forms pores, triggering pyroptosis (PubMed : 32929201, PubMed : 34012073). Initiates pyroptosis following inactivation of MAP3K7/TAK1 (By similarity). Also acts as a regulator of innate immunity by mediating cleavage and inactivation of N4BP1 downstream of TLR3 or TLR4, thereby promoting cytokine production (By similarity). May participate in the Granzyme B (GZMB) cell death pathways (PubMed : 8755496). Cleaves PARP1 and PARP2 (PubMed : 8681376). Independent of its protease activity, promotes cell migration following phosphorylation at Tyr-380 (PubMed : 18216014, PubMed : 27109099).. Isoform 5. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.. Isoform 6. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.. Isoform 7. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex (Probable). Acts as an inhibitor of the caspase cascade (PubMed : 12010809).. Isoform 8. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.

Sequence similarities

Belongs to the peptidase C14A family.

Post-translational modifications

Generation of the p10 and p18 subunits requires association with the death-inducing signaling complex (DISC), whereas additional processing is likely due to the autocatalytic activity of the activated protease. GZMB and CASP10 can be involved in these processing events.. Phosphorylation on Ser-387 during mitosis by CDK1 inhibits activation by proteolysis and prevents apoptosis (PubMed:20937773). Phosphorylation on Tyr-380 by SRC is mediated by interaction with the SRC SH2 domain and does not affect dimerization or recruitment to the death-inducing signaling complex (DISC) but negatively regulates DISC-mediated processing and activation of CASP8, down-regulating its proapoptotic function (PubMed:16619028, PubMed:27109099). Phosphorylation on Tyr-380 also enhances localization to lamellipodia in migrating cells (PubMed:18216014).. (Microbial infection) ADP-riboxanation by C.violaceum CopC blocks CASP8 processing, preventing CASP8 activation and ability to mediate extrinsic apoptosis.. (Microbial infection) Proteolytically cleaved by the cowpox virus CRMA death inhibitory protein.

Subcellular localisation

Nucleus

Product protocols

Target data

Thiol protease that plays a key role in programmed cell death by acting as a molecular switch for apoptosis, necroptosis and pyroptosis, and is required to prevent tissue damage during embryonic development and adulthood (PubMed : 23516580, PubMed : 35338844, PubMed : 35446120, PubMed : 8681376, PubMed : 8681377, PubMed : 8962078, PubMed : 9006941, PubMed : 9184224). Initiator protease that induces extrinsic apoptosis by mediating cleavage and activation of effector caspases responsible for FAS/CD95-mediated and TNFRSF1A-induced cell death (PubMed : 23516580, PubMed : 35338844, PubMed : 35446120, PubMed : 8681376, PubMed : 8681377, PubMed : 8962078, PubMed : 9006941, PubMed : 9184224). Cleaves and activates effector caspases CASP3, CASP4, CASP6, CASP7, CASP9 and CASP10 (PubMed : 16916640, PubMed : 8962078, PubMed : 9006941). Binding to the adapter molecule FADD recruits it to either receptor FAS/TNFRSF6 or TNFRSF1A (PubMed : 8681376, PubMed : 8681377). The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation (PubMed : 9184224). The active dimeric enzyme is then liberated from the DISC and free to activate downstream apoptotic proteases (PubMed : 9184224). Proteolytic fragments of the N-terminal propeptide (termed CAP3, CAP5 and CAP6) are likely retained in the DISC (PubMed : 9184224). Also cleaves and activates BID, thereby promoting cytochrome C release from mitochrondria (By similarity). In addition to extrinsic apoptosis, also acts as a negative regulator of necroptosis : acts by cleaving RIPK1 at 'Asp-324', which is crucial to inhibit RIPK1 kinase activity, limiting TNF-induced apoptosis, necroptosis and inflammatory response (PubMed : 31827280, PubMed : 31827281). Also able to initiate pyroptosis by mediating cleavage and activation of gasdermin-C and -D (GSDMC and GSDMD, respectively) : gasdermin cleavage promotes release of the N-terminal moiety that binds to membranes and forms pores, triggering pyroptosis (PubMed : 32929201, PubMed : 34012073). Initiates pyroptosis following inactivation of MAP3K7/TAK1 (By similarity). Also acts as a regulator of innate immunity by mediating cleavage and inactivation of N4BP1 downstream of TLR3 or TLR4, thereby promoting cytokine production (By similarity). May participate in the Granzyme B (GZMB) cell death pathways (PubMed : 8755496). Cleaves PARP1 and PARP2 (PubMed : 8681376). Independent of its protease activity, promotes cell migration following phosphorylation at Tyr-380 (PubMed : 18216014, PubMed : 27109099).. Isoform 5. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.. Isoform 6. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.. Isoform 7. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex (Probable). Acts as an inhibitor of the caspase cascade (PubMed : 12010809).. Isoform 8. Lacks the catalytic site and may interfere with the pro-apoptotic activity of the complex.
See full target information CASP8

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Acta pharmacologica Sinica : PubMed32457417

2020

Gasdermin E-derived caspase-3 inhibitors effectively protect mice from acute hepatic failure.

Applications

Unspecified application

Species

Unspecified reactive species

Wan-Feng Xu,Quan Zhang,Chu-Jie Ding,Hui-Yong Sun,Yuan Che,Hai Huang,Yun Wang,Jia-Wei Wu,Hai-Ping Hao,Li-Juan Cao
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com