JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114274

Recombinant Human CaSR protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CaSR protein (GST tag N-Terminus) is a Human Fragment protein, in the 21 to 130 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

GPRC2A, PCAR1, CASR, Extracellular calcium-sensing receptor, CaR, CaSR, hCasR, Parathyroid cell calcium-sensing receptor 1, PCaR1

1 Images
SDS-PAGE - Recombinant Human CaSR protein (GST tag N-Terminus) (AB114274)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CaSR protein (GST tag N-Terminus) (AB114274)

12.5% SDS-PAGE analysis of ab114274 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P41180

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(recombinant protein)</p>" } } }

Product details

This product was previously labelled as Calcium Sensing Receptor.

Sequence info

[{"sequence":"GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCN","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":130,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P41180","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The calcium-sensing receptor often referred to as CaSR is a critical G-protein coupled receptor involved in calcium ion homeostasis. Also known as CASR this receptor detects changes in extracellular calcium concentration and modulates signaling pathways accordingly. The CaSR protein has a molecular weight of approximately 120 kDa. It is mainly expressed in the parathyroid gland kidney and several other tissues playing a significant role in regulating serum calcium levels.
Biological function summary

The calcium-sensing receptor modulates parathyroid hormone secretion and renal calcium excretion in response to calcium fluctuations. Although not typically part of a larger protein complex it interacts with several other proteins to perform its functions efficiently. CaSR ensures the stability of calcium concentration which is essential for bone health muscle contraction and nerve function.

Pathways

Several other proteins work alongside the calcium-sensing receptor in the calcium signaling and parathyroid hormone secretion pathways. In particular CaSR influences the MAPK pathway which impacts cell growth and differentiation. Phosphate transporters and calbindins are related to CaSR within these pathways indicating its broad scope in calcium metabolism.

The calcium-sensing receptor is closely associated with conditions like hypercalcemia and autosomal dominant hypocalcemia. CaSR mutations can result in dysfunctional calcium regulation impacting parathyroid hormone levels. The relationship between CaSR and parathyroid hormone-related peptide highlights its significance in maintaining calcium balance and preventing skeletal and neurological complications.

Specifications

Form

Liquid

General info

Function

G-protein-coupled receptor that senses changes in the extracellular concentration of calcium ions and plays a key role in maintaining calcium homeostasis (PubMed : 17555508, PubMed : 19789209, PubMed : 21566075, PubMed : 22114145, PubMed : 22789683, PubMed : 23966241, PubMed : 25104082, PubMed : 25292184, PubMed : 25766501, PubMed : 26386835, PubMed : 32817431, PubMed : 33603117, PubMed : 34194040, PubMed : 34467854, PubMed : 7759551, PubMed : 8636323, PubMed : 8702647, PubMed : 8878438). Senses fluctuations in the circulating calcium concentration : activated by elevated circulating calcium, leading to decreased parathyroid hormone (PTH) secretion in parathyroid glands (By similarity). In kidneys, acts as a key regulator of renal tubular calcium resorption (By similarity). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G-proteins) and modulates the activity of downstream effectors (PubMed : 38632411). CASR is coupled with different G(q)/G(11), G(i)/G(o)- or G(s)-classes of G-proteins depending on the context (PubMed : 38632411). In the parathyroid and kidney, CASR signals through G(q)/G(11) and G(i)/G(o) G-proteins : G(q)/G(11) coupling activates phospholipase C-beta, releasing diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) second messengers, while G(i)/G(o) coupling mediates inhibition of adenylate cyclase activity (PubMed : 38632411, PubMed : 7759551). The G-protein-coupled receptor activity is activated by a co-agonist mechanism : aromatic amino acids, such as Trp or Phe, act concertedly with divalent cations, such as calcium or magnesium, to achieve full receptor activation (PubMed : 27386547, PubMed : 27434672, PubMed : 32817431, PubMed : 33603117, PubMed : 34194040). Acts as an activator of the NLRP3 inflammasome via G(i)/G(o)-mediated signaling : down-regulation of cyclic AMP (cAMP) relieving NLRP3 inhibition by cAMP (PubMed : 32843625). Acts as a regulator of proton-sensing receptor GPR68 in a seesaw manner : CASR-mediated signaling inhibits GPR68 signaling in response to extracellular calcium, while GPR68 inhibits CASR in presence of extracellular protons (By similarity).

Sequence similarities

Belongs to the G-protein coupled receptor 3 family.

Post-translational modifications

Phosphorylation at Thr-888 by PKC impairs coupling with G(q)/G(11) G-proteins, while it does not affect G(i)/G(o)-coupling (PubMed:17376781, PubMed:38326620, PubMed:9694886). Phosphorylation at Ser-892 by PKC and Ser-899 by PKA promote plasma membrane localization (PubMed:20798521).. Ubiquitinated by RNF19A; which induces proteasomal degradation.. N-glycosylated.

Product protocols

Target data

G-protein-coupled receptor that senses changes in the extracellular concentration of calcium ions and plays a key role in maintaining calcium homeostasis (PubMed : 17555508, PubMed : 19789209, PubMed : 21566075, PubMed : 22114145, PubMed : 22789683, PubMed : 23966241, PubMed : 25104082, PubMed : 25292184, PubMed : 25766501, PubMed : 26386835, PubMed : 32817431, PubMed : 33603117, PubMed : 34194040, PubMed : 34467854, PubMed : 7759551, PubMed : 8636323, PubMed : 8702647, PubMed : 8878438). Senses fluctuations in the circulating calcium concentration : activated by elevated circulating calcium, leading to decreased parathyroid hormone (PTH) secretion in parathyroid glands (By similarity). In kidneys, acts as a key regulator of renal tubular calcium resorption (By similarity). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G-proteins) and modulates the activity of downstream effectors (PubMed : 38632411). CASR is coupled with different G(q)/G(11), G(i)/G(o)- or G(s)-classes of G-proteins depending on the context (PubMed : 38632411). In the parathyroid and kidney, CASR signals through G(q)/G(11) and G(i)/G(o) G-proteins : G(q)/G(11) coupling activates phospholipase C-beta, releasing diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) second messengers, while G(i)/G(o) coupling mediates inhibition of adenylate cyclase activity (PubMed : 38632411, PubMed : 7759551). The G-protein-coupled receptor activity is activated by a co-agonist mechanism : aromatic amino acids, such as Trp or Phe, act concertedly with divalent cations, such as calcium or magnesium, to achieve full receptor activation (PubMed : 27386547, PubMed : 27434672, PubMed : 32817431, PubMed : 33603117, PubMed : 34194040). Acts as an activator of the NLRP3 inflammasome via G(i)/G(o)-mediated signaling : down-regulation of cyclic AMP (cAMP) relieving NLRP3 inhibition by cAMP (PubMed : 32843625). Acts as a regulator of proton-sensing receptor GPR68 in a seesaw manner : CASR-mediated signaling inhibits GPR68 signaling in response to extracellular calcium, while GPR68 inhibits CASR in presence of extracellular protons (By similarity).
See full target information CASR

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com