JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140725

Recombinant Human Cathelicidin/CLP protein (denatured)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human Cathelicidin/CLP protein (denatured) is a Human Full Length protein, in the 30 to 170 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

CAP18, FALL39, HSD26, CAMP, Cathelicidin antimicrobial peptide, 18 kDa cationic antimicrobial protein, CAP-18, hCAP-18

1 Images
SDS-PAGE - Recombinant Human Cathelicidin/CLP protein (denatured) (AB140725)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Cathelicidin/CLP protein (denatured) (AB140725)

SDS-PAGE analysis of ab140725 (3 μg) under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P49913

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Cathelicidin

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES","proteinLength":"Full Length","predictedMolecularWeight":"18.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":170,"aminoAcidStart":30,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49913","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cathelicidin also known as LL-37 peptide is an antimicrobial peptide with a mass of around 18 kDa. It plays an important role in the innate immune system by disrupting microbial membranes. LL-37 is expressed in various tissues including skin mucosal surfaces and certain immune cells. These peptides protect the host from infection by directly killing bacteria viruses and fungi and by modulating immune responses.
Biological function summary

Peptides like Cathelicidin are essential for host defense mechanisms contributing to cell signaling and pathogen clearance. LL-37 does not function within a complex but acts independently to influence immune cell chemotaxis. It promotes wound healing angiogenesis and tissue repair thereby ensuring rapid response to injury or infection.

Pathways

Cathelicidin interacts within inflammatory and wound healing pathways. It is involved in the NF-kB signaling pathway which regulates immune response and is linked to TLR (Toll-like receptor) pathways impacting cytokine production and further immune modulation. Proteins such as defensins share similar pathways indicating their collective influence in antimicrobial defense and tissue repair.

Peptides like Cathelicidin are associated with conditions like psoriasis and atopic dermatitis. Overexpression or dysregulation of LL-37 can exacerbate inflammation in these autoimmune skin disorders. Related to these diseases proteins such as interleukins (IL-1 and IL-6) are often co-expressed or influenced by Cathelicidin levels indicating their intertwined role in skin homeostasis and immune responses.

Specifications

Form

Liquid

General info

Function

Antimicrobial protein that is an integral component of the innate immune system (PubMed : 14978112, PubMed : 16637646, PubMed : 18818205, PubMed : 22879591, PubMed : 9736536). Binds to bacterial lipopolysaccharides (LPS) (PubMed : 16637646, PubMed : 18818205). Acts via neutrophil N-formyl peptide receptors to enhance the release of CXCL2 (PubMed : 22879591). Postsecretory processing generates multiple cathelicidin antimicrobial peptides with various lengths which act as a topical antimicrobial defense in sweat on skin (PubMed : 14978112). The unprocessed precursor form, cathelicidin antimicrobial peptide, inhibits the growth of Gram-negative E.coli and E.aerogenes with efficiencies comparable to that of the mature peptide LL-37 (in vitro) (PubMed : 9736536).. Antibacterial peptide LL-37. Antimicrobial peptide that is an integral component of the innate immune system (PubMed : 10417311, PubMed : 15778390, PubMed : 16637646, PubMed : 18818205, PubMed : 22879591, PubMed : 32753597, PubMed : 33060695, PubMed : 34708076, PubMed : 8681941, PubMed : 9736536). Binds to bacterial lipopolysaccharides (LPS) (PubMed : 10417311, PubMed : 16637646, PubMed : 18818205, PubMed : 33060695, PubMed : 9736536). Causes membrane permeabilization by forming transmembrane pores (in vitro) (PubMed : 22879591, PubMed : 32753597, PubMed : 33060695). Causes lysis of E.coli (PubMed : 10417311). Exhibits antimicrobial activity against Gram-negative bacteria such as P.aeruginosa, S.typhimurium, E.aerogenes, E.coli and P.syringae, Gram-positive bacteria such as L.monocytogenes, S.epidermidis, S.pyogenes and S.aureus, as well as vancomycin-resistant enterococci (in vitro) (PubMed : 10417311, PubMed : 32753597, PubMed : 8681941, PubMed : 9736536). Exhibits antimicrobial activity against methicillin-resistant S.aureus, P.mirabilis, and C.albicans in low-salt media, but not in media containing 100 mM NaCl (in vitro) (PubMed : 9736536). Forms chiral supramolecular assemblies with quinolone signal (PQS) molecules of P.aeruginosa, which may lead to interference of bacterial quorum signaling and perturbance of bacterial biofilm formation (PubMed : 34708076). May form supramolecular fiber-like assemblies on bacterial membranes (PubMed : 29133814). Induces cytokine and chemokine production as well as TNF/TNFA and CSF2/GMCSF production in normal human keratinocytes (PubMed : 15778390). Exhibits hemolytic activity against red blood cells (PubMed : 10417311).. Antibacterial peptide FALL-39. Exhibits antimicrobial activity against E.coli and B.megaterium (in vitro).. Antibacterial peptide KR-20. Acts synergistically with peptides KS-30 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintains activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide LL-23. Poorly active (MIC > 150 uM) against E.coli strain K12 (PubMed : 14978112). Is able to induce the pro-inflammatory cytokine TNF/TNFA or the chemokine CCL2/MCP1 (PubMed : 14978112).. Antibacterial peptide LL-29. Moderately antibacterial.. Antibacterial peptide KS-30. Moderately antibacterial (PubMed : 14978112). Acts synergistically with peptides KR-20 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintain activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide RK-31. Acts synergistically with peptides KS-30 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintain activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide FF-33. Inhibits the growth of E.coli and B.megaterium and exhibits hemolytic activity against human red blood cells.

Sequence similarities

Belongs to the cathelicidin family.

Post-translational modifications

The N-terminus is blocked.. Proteolytically cleaved by proteinase PRTN3 into antibacterial peptide LL-37 (PubMed:11389039). Proteolytically cleaved by cathepsin CTSG and neutrophil elastase ELANE (PubMed:11389039, PubMed:22879591).. Antibacterial peptide LL-37. Resistant to proteolytic degradation in solution, and when bound to both zwitterionic (mimicking mammalian membranes) and negatively charged membranes (mimicking bacterial membranes).. After secretion onto the skin surface, the CAMP gene product is processed by a serine protease-dependent mechanism into multiple novel antimicrobial peptides distinct from and shorter than cathelicidin LL-37, such as peptides KR-20 (residues 151-170), LL-23 (residues 134-156), LL-29 (residues 134-162), KS-30 (residues 141-170), RK-31 (residues 140-170) and FF-33 (residues 138-170) (PubMed:14978112). The peptides act synergistically, killing bacteria at lower concentrations when present together, and maintain activity at increased salt condition (PubMed:14978112).

Product protocols

Target data

Antimicrobial protein that is an integral component of the innate immune system (PubMed : 14978112, PubMed : 16637646, PubMed : 18818205, PubMed : 22879591, PubMed : 9736536). Binds to bacterial lipopolysaccharides (LPS) (PubMed : 16637646, PubMed : 18818205). Acts via neutrophil N-formyl peptide receptors to enhance the release of CXCL2 (PubMed : 22879591). Postsecretory processing generates multiple cathelicidin antimicrobial peptides with various lengths which act as a topical antimicrobial defense in sweat on skin (PubMed : 14978112). The unprocessed precursor form, cathelicidin antimicrobial peptide, inhibits the growth of Gram-negative E.coli and E.aerogenes with efficiencies comparable to that of the mature peptide LL-37 (in vitro) (PubMed : 9736536).. Antibacterial peptide LL-37. Antimicrobial peptide that is an integral component of the innate immune system (PubMed : 10417311, PubMed : 15778390, PubMed : 16637646, PubMed : 18818205, PubMed : 22879591, PubMed : 32753597, PubMed : 33060695, PubMed : 34708076, PubMed : 8681941, PubMed : 9736536). Binds to bacterial lipopolysaccharides (LPS) (PubMed : 10417311, PubMed : 16637646, PubMed : 18818205, PubMed : 33060695, PubMed : 9736536). Causes membrane permeabilization by forming transmembrane pores (in vitro) (PubMed : 22879591, PubMed : 32753597, PubMed : 33060695). Causes lysis of E.coli (PubMed : 10417311). Exhibits antimicrobial activity against Gram-negative bacteria such as P.aeruginosa, S.typhimurium, E.aerogenes, E.coli and P.syringae, Gram-positive bacteria such as L.monocytogenes, S.epidermidis, S.pyogenes and S.aureus, as well as vancomycin-resistant enterococci (in vitro) (PubMed : 10417311, PubMed : 32753597, PubMed : 8681941, PubMed : 9736536). Exhibits antimicrobial activity against methicillin-resistant S.aureus, P.mirabilis, and C.albicans in low-salt media, but not in media containing 100 mM NaCl (in vitro) (PubMed : 9736536). Forms chiral supramolecular assemblies with quinolone signal (PQS) molecules of P.aeruginosa, which may lead to interference of bacterial quorum signaling and perturbance of bacterial biofilm formation (PubMed : 34708076). May form supramolecular fiber-like assemblies on bacterial membranes (PubMed : 29133814). Induces cytokine and chemokine production as well as TNF/TNFA and CSF2/GMCSF production in normal human keratinocytes (PubMed : 15778390). Exhibits hemolytic activity against red blood cells (PubMed : 10417311).. Antibacterial peptide FALL-39. Exhibits antimicrobial activity against E.coli and B.megaterium (in vitro).. Antibacterial peptide KR-20. Acts synergistically with peptides KS-30 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintains activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide LL-23. Poorly active (MIC > 150 uM) against E.coli strain K12 (PubMed : 14978112). Is able to induce the pro-inflammatory cytokine TNF/TNFA or the chemokine CCL2/MCP1 (PubMed : 14978112).. Antibacterial peptide LL-29. Moderately antibacterial.. Antibacterial peptide KS-30. Moderately antibacterial (PubMed : 14978112). Acts synergistically with peptides KR-20 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintain activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide RK-31. Acts synergistically with peptides KS-30 and KR-31, killing bacteria such as S.aureus, E.coli and C.albicans at lower concentrations when present together, and maintain activity at increased salt condition (PubMed : 14978112). Does not have the ability to stimulate CXCL8/IL8 release from keratinocytes (PubMed : 14978112).. Antibacterial peptide FF-33. Inhibits the growth of E.coli and B.megaterium and exhibits hemolytic activity against human red blood cells.
See full target information CAMP

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Biomolecules 9: PubMed31766659

2019

Salivary Protein Panel to Diagnose Systolic Heart Failure.

Applications

Unspecified application

Species

Unspecified reactive species

Xi Zhang,Daniel Broszczak,Karam Kostner,Kristyan B Guppy-Coles,John J Atherton,Chamindie Punyadeera

The European respiratory journal 50: PubMed28890436

2017

Primary ciliary dyskinesia ciliated airway cells show increased susceptibility to biofilm formation.

Applications

Unspecified application

Species

Unspecified reactive species

Woolf T Walker,Claire L Jackson,Raymond N Allan,Samuel A Collins,Michael J Kelso,Ardeshir Rineh,Nageshwar R Yepuri,Ben Nicholas,Laurie Lau,David Johnston,Peter Lackie,Saul N Faust,Jane S A Lucas,Luanne Hall-Stoodley
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com