JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114170

Recombinant Human Caveolin-1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Caveolin-1 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 178 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CAV, CAV1, Caveolin-1

3 Images
Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)
  • WB

Unknown

Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)

ab18199 recognizes the full length tagged recombinant Caveolin 1 protein (ab114170) which has an expected molecular weight of 46 kDa.

All lanes:

Western blot - Anti-Caveolin-1 antibody - Caveolae Marker (<a href='/en-us/products/primary-antibodies/caveolin-1-antibody-caveolae-marker-ab18199'>ab18199</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (ab114170) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 20 kDa

true

Exposure time: 1min

Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)
  • WB

Unknown

Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)

ab18199 recognizes the full length tagged recombinant Caveolin 1 protein (ab114170) which has an expected molecular weight of 46 kDa.

All lanes:

Western blot - Anti-Caveolin-1 antibody - Caveolae Marker (<a href='/en-us/products/primary-antibodies/caveolin-1-antibody-caveolae-marker-ab18199'>ab18199</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (ab114170) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 20 kDa

true

Exposure time: 1min

SDS-PAGE - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Caveolin-1 protein (GST tag N-Terminus) (AB114170)

ab114170 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

Q03135

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab114170 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/caveolin-1-antibody-caveolae-marker-ab18199'>ab18199</a>.</p>" } } }

Sequence info

[{"sequence":"MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI","proteinLength":"Full Length","predictedMolecularWeight":"45.58 kDa","actualMolecularWeight":null,"aminoAcidEnd":178,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q03135","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Caveolin-1 also known as Cav-1 is an integral membrane protein with a molecular weight of approximately 22 kDa. It functions mechanically as a scaffolding protein in caveolae which are tiny invaginations in the plasma membrane of many cell types. These structures are particularly abundant in adipocytes endothelial cells and muscle cells. Caveolin-1 anchors itself to the cell membrane and plays a role in organizing and concentrating certain signaling molecules.
Biological function summary

Caveolae provide a platform for various signaling pathways and involve caveolin-1 as a major component. Caveolin-1 interacts with multiple signaling molecules such as G-protein coupled receptors and Src family kinases to modulate signal transduction. This protein forms part of a larger caveolar complex contributing to cellular processes including endocytosis and lipid regulation. Its presence as a marker in caveolae highlights its significance in cellular functions.

Pathways

Caveolin-1 influences the insulin signaling and nitric oxide (NO) signaling pathways. In the insulin signaling pathway caveolin-1 interacts with insulin receptors to modulate glucose uptake. It also associates with eNOS (endothelial nitric oxide synthase) in the NO signaling pathway impacting vascular function. These relationships highlight its role in cellular communication and regulatory mechanisms within the human body.

Caveolin-1 is involved in cancer and cardiovascular diseases. In cancer altered expression of caveolin-1 contributes to tumor progression while in cardiovascular diseases it affects endothelial function through its interaction with eNOS. The connection of caveolin-1 to proteins like insulin receptors and eNOS reveals its critical influence in these conditions providing potential targets for therapeutic intervention.

Specifications

Form

Liquid

General info

Function

May act as a scaffolding protein within caveolar membranes (PubMed : 11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed : 19262564). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (PubMed : 17287217). Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (PubMed : 25893292). Binds 20(S)-hydroxycholesterol (20(S)-OHC) (By similarity).

Sequence similarities

Belongs to the caveolin family.

Post-translational modifications

Ubiquitinated. Undergo monoubiquitination and multi- and/or polyubiquitination (PubMed:21822278). Monoubiquitination of N-terminal lysines promotes integration in a ternary complex with UBXN6 and VCP which promotes oligomeric CAV1 targeting to lysosomes for degradation (PubMed:23335559). Ubiquitinated by ZNRF1; leading to degradation and modulation of the TLR4-mediated immune response (PubMed:28593998).. The initiator methionine for isoform 2 is removed during or just after translation. The new N-terminal amino acid is then N-acetylated.. Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress.

Product protocols

Target data

May act as a scaffolding protein within caveolar membranes (PubMed : 11751885). Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae (PubMed : 19262564). Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner (PubMed : 17287217). Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway (By similarity). Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation (PubMed : 25893292). Binds 20(S)-hydroxycholesterol (20(S)-OHC) (By similarity).
See full target information CAV1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com