JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB283922

Recombinant Human CCL13 Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CCL13 Protein (Active) is a Human Full Length protein, in the 24 to 98 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec, FuncS, HPLC.

View Alternative Names

MCP4, NCC1, SCYA13, CCL13, C-C motif chemokine 13, CK-beta-10, Monocyte chemoattractant protein 4, Monocyte chemotactic protein 4, NCC-1, Small-inducible cytokine A13, MCP-4

4 Images
Biochemical assay - Recombinant Human CCL13 Protein (Active) (AB283922)
  • Biochemical assay

Supplier Data

Biochemical assay - Recombinant Human CCL13 Protein (Active) (AB283922)

Fully biologically active determined by the dose dependent measurement of beta-arrestin recruitment on CCR3 using CHO-K1 overexpressing human CCR3/beta-arrestin/beta-galactosidase complementation system. ED50 is ≤ 181 ng/ml, corresponding to a specific activity of 5.5 x 103 units/mg.

Mass Spectrometry - Recombinant Human CCL13 Protein (Active) (AB283922)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human CCL13 Protein (Active) (AB283922)

ESI TOF analysis of ab283922.

Predicted MW is 8656.21 Da( +/- 10 Da by ESI TOF). Observed MW is 8655.74 Da.

SDS-PAGE - Recombinant Human CCL13 Protein (Active) (AB283922)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CCL13 Protein (Active) (AB283922)

SDS-PAGE analysis of ab283922.

HPLC - Recombinant Human CCL13 Protein (Active) (AB283922)
  • HPLC

Supplier Data

HPLC - Recombinant Human CCL13 Protein (Active) (AB283922)

HPLC analysis of ab283922.

Key facts

Purity

>95% SDS-PAGE

Purity by HPLC =95%

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS, Mass Spec, HPLC

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by the dose dependent measurement of beta-arrestin recruitment on CCR3 using CHO-K1 overexpressing human CCR3/beta-arrestin/beta-galactosidase complementation system.

ED50 is ≤ 181 ng/ml, corresponding to a specific activity of 5.5x 103 units/mg.

Accession

Q99616

Animal free

Yes

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT","proteinLength":"Full Length","predictedMolecularWeight":"8.66 kDa","actualMolecularWeight":"8.66 kDa","aminoAcidEnd":98,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q99616","tags":[]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

MCP4 also known as CCL13 is a chemokine with a molecular mass of approximately 11 kDa. It plays a critical role in attracting immune cells to sites of inflammation. MCP4 achieves this through its interaction with G protein-coupled receptors particularly CCR2 and CCR3. The protein is primarily expressed in tissues involved in immune responses including lymph nodes spleen and bone marrow. It exhibits high expression levels at sites of allergic inflammation suggesting a specific role in these processes.
Biological function summary

MCP4 functions by mediating the recruitment of monocytes eosinophils and T lymphocytes. It is not part of a larger protein complex but rather operates as part of the chemokine signaling family. MCP4 is particularly active in coordinating responses to allergens and pathogens therefore highlighting its importance in the body's defense mechanisms. As a member of the C-C motif chemokine family it shares structural characteristics with other chemokines like CCL11 which participate in similar immune cell trafficking functions.

Pathways

MCP4 is deeply involved in inflammatory and immune pathways specifically the chemokine signaling pathway and the cytokine-cytokine receptor interaction pathway. MCP4 guides immune cells allowing them to respond effectively to cytokine signals ensuring their migration to necessary sites. Through the chemokine signaling pathway it collaborates with related chemokines like CCL5 to enhance immune responses. Its interaction with these pathways highlights its role in both routine immunity and inflammatory responses positioning it as an important player in maintaining immune homeostasis.

MCP4 correlates with conditions such as asthma and allergic rhinitis. Both of these conditions involve chronic inflammation where MCP4's role becomes more pronounced. In asthma the protein contributes to the recruitment of eosinophils and other immune cells that drive the inflammatory processes. MCP4 interactions with proteins like CCR3 are significant in exacerbating symptoms of allergic disorders making it an important target for therapeutic research aimed at modulating inflammatory responses in these diseases.

General info

Function

Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens.

Sequence similarities

Belongs to the intercrine beta (chemokine CC) family.

Post-translational modifications

One major form (form long), and two minor forms (short chain and medium chain) are produced by differential signal peptide cleavage. The medium chain is about 30-fold less active than the long chain.

Product protocols

Target data

Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens.
See full target information CCL13

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com